KEGG   Meriones unguiculatus (Mongolian gerbil): 110565162Help
Entry
110565162         CDS       T05884                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC18-like
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     110565162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF3925
Motif
Other DBs
NCBI-GeneID: 110565162
NCBI-ProteinID: XP_021518467
Position
Unknown
AA seq 250 aa AA seqDB search
MVFYVALPLTKEVTSQPEKCDGGPTLTEPTGLTTFPTILKQLARENGDTCCIIILYEIQA
LGGGVFASQMVLGAGAEGTVAQNVRELFVSKCCPYLAVNITPAIPAVGGILFFFVMGTLL
RTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTC
KIFRPPRASHCSLCDNCVERFDHHCPWVHSKRDSSMPLRTVQRDILSSGSVGTCGFSVES
LIENIRLYDE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggtattctacgtagcattgcctctgaccaaggaagtcacttcacagccagagaagtgt
gacggtgggcccacactcacggagcccactggtcttaccacgtttcccaccatcctgaag
cagctggcccgagagaatggtgacacttgctgtatcatcatcttgtatgaaatccaggcc
ctcgggggtggagtctttgcatcacagatggtgcttggtgctggagccgagggcaccgtt
gctcagaatgtgagggagctgtttgtttccaagtgctgtccgtacctcgcagtgaacatc
acacctgccatccctgcggtcggaggcatcttgttcttctttgtcatggggactctgctt
cggaccagcttcagtgatccaggagtcctccctcgagccaccccggatgaagccgctgat
ctggaaaggcaaatagacattgccaatggcaccagttcaggggggtaccgcccgcctccc
agaaccaaagaagtcatcatcaatggccagactgtgaaactaaaatactgtttcacctgc
aagattttccggccccctcgagcctcccactgtagcttgtgtgataactgcgtagaacgg
tttgatcaccactgtccctgggttcacagcaaacgggattcctcaatgcccttaaggaca
gtccagcgagatatcctttccagtggctctgtggggacttgtgggttcagtgttgagagc
cttatagaaaacattcgcttgtatgatgaatga

DBGET integrated database retrieval system