KEGG   Meriones unguiculatus (Mongolian gerbil): 110565393
Entry
110565393         CDS       T05884                                 

Gene name
Apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04080  Neuroactive ligand-receptor interaction
mun04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110565393 (Apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110565393 (Apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 110565393
NCBI-ProteinID: XP_021518757
Position
Unknown
AA seq 77 aa
MNLGLCMQALLLLWLSLTAVCGVPLMLPPDGKGLEEGNMHYLVQPRASRAGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctggggctctgcatgcaggcgctgctgctactctggctctccttgactgcggtg
tgtggagtgccactgatgctgcctccagacgggaaagggctagaagaaggcaacatgcac
tacctggtgcagcccagagcttcgagggctggaccagggccctggcagggaggcaggagg
aaatttcgcagacaacgtcctcgtctctcccataagggccccatgcctttctga

DBGET integrated database retrieval system