KEGG   Meriones unguiculatus (Mongolian gerbil): 110565567Help
Entry
110565567         CDS       T05884                                 

Gene name
Ctso
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04142  Lysosome
mun04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110565567 (Ctso)
  09143 Cell growth and death
   04210 Apoptosis
    110565567 (Ctso)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mun01002]
    110565567 (Ctso)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     110565567 (Ctso)
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C1: papain family
   110565567 (Ctso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 110565567
NCBI-ProteinID: XP_021518939
Position
Unknown
AA seq 312 aa AA seqDB search
MERRWANPLLLCCCCCLGLGVTRTWPWSLERETAALRESVNRHRYLNSFSHENSTAFYGI
NQFSYLFPEEFKALYLGSKPAWSPRYPAEGQTPIPNVSLPSRFDWRDKRVVNQVRNQKMC
GGCWAFSVVGAIESARAIQGKPLDFLSVQQVIDCSFNNYGCSGGSPFSALSWLNETQVKL
VADSEYPFKAENGLCRYFPQSQSGVSVKDFSAYGFSDQEDEMAKALVTFGPLVVLVDAVS
WQDYLGGIIQHHCSSGEANHAVLITGFDKTGNTPFWIVRNSWGKAWGVEGYAHVKMGANV
CGIADSVSAVFV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcggtgggccaacccgctgctgctgtgctgctgctgctgtctcggccttggg
gttacccggacctggccttggagcctcgagcgggagacggcagccttgcgggaaagtgtt
aatagacatcgatacttgaactctttttctcatgaaaactctactgccttctatggaata
aatcagttttcttatttgtttcctgaagagtttaaagctctatatttaggcagcaaacct
gcctggtctcccagatacccagcggaaggacagacccctatccccaatgtgtctttgccg
tcgagatttgactggagggacaaacgtgttgtaaatcaagtgaggaaccagaagatgtgt
ggaggatgctgggccttcagcgtggtgggggcaatagagtcagctcgtgcgatccaaggg
aagccattggatttcctcagcgtgcagcaggtcatcgactgctcctttaataattacggc
tgcagcgggggctcccctttcagtgccttgagctggctaaatgagacacaggtaaagttg
gtggcagattcagaatacccattcaaggcagaaaatggcctgtgtcgctactttcctcag
tcacagtccggagtttctgtcaaggatttttctgcgtatggcttcagtgaccaagaagac
gaaatggcaaaagcccttgtgaccttcggccctttggttgtgctagtggatgcagtgagc
tggcaggattatctggggggcataatccagcaccactgctccagtggggaggcaaaccac
gcggtcctcatcacgggctttgataaaacaggaaatactcctttttggatcgtgcggaac
tcgtgggggaaagcctggggtgtagaaggctatgcccacgtgaaaatgggagctaatgtg
tgtggcattgcagactctgtctctgctgtctttgtgtga

DBGET integrated database retrieval system