KEGG   Meriones unguiculatus (Mongolian gerbil): 110566361Help
Entry
110566361         CDS       T05884                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04260  Cardiac muscle contraction
mun04261  Adrenergic signaling in cardiomyocytes
mun04911  Insulin secretion
mun04918  Thyroid hormone synthesis
mun04919  Thyroid hormone signaling pathway
mun04925  Aldosterone synthesis and secretion
mun04960  Aldosterone-regulated sodium reabsorption
mun04961  Endocrine and other factor-regulated calcium reabsorption
mun04964  Proximal tubule bicarbonate reclamation
mun04970  Salivary secretion
mun04971  Gastric acid secretion
mun04972  Pancreatic secretion
mun04973  Carbohydrate digestion and absorption
mun04974  Protein digestion and absorption
mun04976  Bile secretion
mun04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    110566361
   04022 cGMP-PKG signaling pathway
    110566361
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110566361
   04918 Thyroid hormone synthesis
    110566361
   04919 Thyroid hormone signaling pathway
    110566361
   04925 Aldosterone synthesis and secretion
    110566361
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110566361
   04261 Adrenergic signaling in cardiomyocytes
    110566361
  09154 Digestive system
   04970 Salivary secretion
    110566361
   04971 Gastric acid secretion
    110566361
   04972 Pancreatic secretion
    110566361
   04976 Bile secretion
    110566361
   04973 Carbohydrate digestion and absorption
    110566361
   04974 Protein digestion and absorption
    110566361
   04978 Mineral absorption
    110566361
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110566361
   04961 Endocrine and other factor-regulated calcium reabsorption
    110566361
   04964 Proximal tubule bicarbonate reclamation
    110566361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110566361
Enzymes [BR:mun01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     110566361
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110566361
  Exosomal proteins of other body fluids (saliva and urine)
   110566361
  Exosomal proteins of colorectal cancer cells
   110566361
  Exosomal proteins of bladder cancer cells
   110566361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cation_ATPase_C Hydrolase Hydrolase_3 Cation_ATPase DUF1290
Motif
Other DBs
NCBI-GeneID: 110566361
NCBI-ProteinID: XP_021519871
Position
Unknown
AA seq 517 aa AA seqDB search
MKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFP
KGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKA
IAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHT
EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAA
DMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTIT
ILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGF
FSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSI
VVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPS
WWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtgcccccgagcgcattctggaccgctgtgccaccatcctcctgcagggcaag
gagcagcctctggatgaggagatgaaggaggccttccagaacgcctacctggagcttggt
ggcctgggcgagcgtgtcctggggttctgccattactacctgccggaggagcagttcccc
aagggcttcgccttcgactgtgacgacgtgaacttcaccacagacaacctttgcttcgtc
ggtctcatgtccatgatcgaccctccccgggcggccgtccctgacgccgtgggcaagtgc
cgcagcgcgggcatcaaggtcatcatggtcactggcgaccaccccatcactgccaaggcc
atcgccaaaggcgtgggcatcatctcagagggcaatgagaccgtggaggacatcgctgcc
cggctgaacatccccgtcagccaggtcaaccccagggatgccaaggcctgtgtgatccac
ggcactgacctcaaggacttcacctctgagcagattgacgagatcctgcagaaccacaca
gagattgtctttgcccgcacctcccctcagcagaagctcatcatcgtggagggctgccag
aggcagggagcaattgtggctgtgactggcgatggtgtcaatgactccccagctctgaag
aaggctgacattggggtggccatgggcatcgctggctctgatgtctccaagcaggctgcc
gacatgattctcctggatgacaattttgcttccatcgtcactggtgtagaggaaggccgc
ctgatctttgacaacctgaagaaatccattgcctacactctgaccagcaacatccctgag
atcacacccttcctgctcttcatcatggccaacatccctctgccccttggtaccatcacc
atcctctgcattgacctgggcaccgacatggtccccgccatctccttggcctacgaggct
gctgagagcgacatcatgaagaggcagcccaggaacccacgcacagacaagctggtcaat
gagaggctcatcagcatggcctatgggcagattgggatgatccaggcccttggcggtttc
ttctcctactttgtcatcctggcagaaaacggcttcttgcccggtaacctggtgggcatc
cggctgaactgggatgaccgtacggtcaatgacctggaagacagctacgggcagcagtgg
acctacgagcagaggaaggtggtggagttcacttgccacacagccttcttcgtgagcatc
gtggtggtccagtgggccgacctgatcatctgcaagaccagaaggaactcagtcttccag
cagggcatgaagaacaagatcttgatcttcggcttgttcgaggagacagccctggcagcc
ttcctgtcctactgcccgggcatggacgtggcccttcgcatgtaccctctcaagcccagc
tggtggttctgtgccttcccgtacagtttcctcatcttcgtctatgatgagatccgcaaa
ctcatcctgcgcaggaaccccgggggttgggtggagaaagagacctactattga

DBGET integrated database retrieval system