KEGG   Meriones unguiculatus (Mongolian gerbil): 110566862Help
Entry
110566862         CDS       T05884                                 

Gene name
Eif3a
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    110566862 (Eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mun03012]
    110566862 (Eif3a)
Translation factors [BR:mun03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    110566862 (Eif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 110566862
NCBI-ProteinID: XP_021520439
Position
Unknown
AA seq 1353 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPT
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRVK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERKITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRGETRDDDRPHRRDEDRLRRLGDDEERESSLRPDDDRIPRR
GLDDDRGPRRGPDEDRFSRRGADDDRPSWRNADDDRPPRRIGDDDRGSWRHTDDDRPLRR
GLDDDRLPRRGLDDDRGSWRTADEDRGPRRGMDEDRGPRRGADDERSSWRNADDDRGPRR
GMDDDRGPRRGLDDDRGPWRNADDDRISRRGADDDRGPWRNMDDDRISRRGDDARPGPWR
PFVKPGGWREKEKAREESWGPPRESRPSEEREWDRDKEKDRENQDREENDKDLERERDRE
RDGDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRDLRERR
DLRDDRDRRGPPLRSEREEASSWRRADDRKDDRTEERDLPRRVPPTAISRDREREREREG
EKEKASWRAEKDRESLRRTKNETDEDGWTTVRR
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaagcgcgccaacgaatttcttgag
gttggcaaaaagcagcctgccctggatgttctttatgatgttatgaaaagtaagaagcac
agaacatggcagaagatacatgagccaattatgttgaaatacttggaactgtgtgtggat
cttcgtaagagccatttggctaaggaagggttatatcaatataagaacatttgtcagcag
gtaaacattaaatctttagaagacgttgttagggcatatttgaaattagcagaggaaaaa
acagaagctgctaaagaagagtcccaacaaatggtgttagatatagaagatctggataat
attcagactcctgagagtgttctcttaagtgcagtaagtggggaagacacccaggatcgc
actgacagattgctactgactccctgggtcaagtttctgtgggaatcatacaggcagtgc
ttggaccttcttcgaaacaattctagagtagagcgtctttaccatgatattgcccagcaa
gctttcaaattctgcctccagtatactcgcaaggctgagttccgcaagctctgtgacaac
ttgcgaatgcacttatcacagattcagcgccaccataaccaaagcacagcaatcaatctt
aataatccagagagccagtccatgcatttggaaaccagacttgttcagttggacagtgct
attagcatggaactatggcaggaagccttcaaagctgtggaagatattcatggattattt
tccttgtctaaaaaaccacctaagcctcagttgatggcaaattattataacaaagtttca
acagtgttttggaaatctggaaatgctctgttccatgcatctacacttcatcgtctttat
catctctctagagaaatgagaaagaatcttacacaagatgagatgcaaaggatgtctact
agagtccttttggcaactctttccattcctattactcctgagcgaactgacattgctcga
cttttggatatggatggtattatagttgagaagcagcgacgccttgcaacactgctaggt
cttcaagccccacccacacgaatcggccttattaatgatatggtcagatttaatgtactg
caatatgttgtcccagaagtgaaagacctttacaactggttggaggtagaattcaaccct
ctaaaactctgtgagagagtcacaaaggtattaaattgggttagggaacaacctgaaaag
gaaccagaattacaacaatatgtaccacaactacagaacaataccatactccgccttctg
cagcaggtggcacagatatatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagccaggcactgtgacctg
caggttcgtattgaccacacttctcggactctgagttttggatcagatttgaattatgca
actcgagaagatgctcccattggtcctcatctgcagagcatgccttcagaacaaataaga
aatcaactcacagcaatgtcctcagtgcttgcaaaagcacttgaggtcatcaagcccact
cacattctgcaagagaaagaagaacaacatcagttggcagttactgcatatcttaaaaat
tcacgaaaagaacatcagcggattctggctcgccgacagacaattgaggaaaggaaagag
cgtcttgagagtctgaatatccaacgtgagaaagaagaactagagcagagggaagctgaa
cttcagaaagtacggaaggctgaagaggagaggcttcgccaggaggcaaaggaacgagaa
aaggaacgaatccttcaggaacatgagcaaattaagaaaaaaactgttcgagagcggtta
gagcagatcaagaagacagaactgggtgccaaagcattcaaagatatagacattgaagac
cttgaagaattggatccagattttatcatggccaaacaggttgaacaactggagaaagaa
aagaaggaacttcaggaacgcctgaagaatcaagaaaagaagattgactattttgaaaga
gctaaacgtttggaagaaattcctttgataaagagtgcttatgaggaacaaagggttaaa
gacatggatctgtgggaacaacaagaagaagaaagaattactacaatgcaactggaacga
gaaaaagctttggaacataagaatcggatgtcacgaatgttggaagacagagacctattt
gtgatgcggctcaaagctgcccggcaatcagtctacgaggaaaaactgaaacagtttgaa
gagcgcttagcagaagaaaggcacaatcgcctggaagaacggaaaagacaacggaaagaa
gaacgcaaaataacttactacagagaaaaggaagaagaagagcagaggagggcagaagaa
caaatgctaaaagagcgagaggaaagagagcgtgctgagagagcaaaacgggaggaagaa
cttagagagtatcaggagcgagtcaagaaactggaggaagtagaaaggaaaaagcggcaa
agagagctggaaattgaagaaagagaaaggcgcagagaggaagagaggagacttggtgat
gatccgctttctaggaaggactctcgttggggagatagagattcagaaggcacatggaga
aaaggaccagaagctgactctgagtggaggagaggaccaccagagaaggagtggagacga
ggagaaactcgggatgatgacaggcctcataggagagatgaggaccggctgaggcgcttg
ggggatgatgaagagagagagtcttctcttagaccagatgatgatcgtatccccaggcgt
ggcctagatgatgacagaggtcctagacgtggtcctgatgaagatagattttctcgtaga
ggagcagacgatgaccgtccttcctggcgtaatgcagatgatgacaggcctccgaggcga
attggtgatgatgacaggggaagctggcgccacacagatgacgacagaccgctcagacgg
ggactagatgacgacagactgcccagacggggactagatgacgacagaggaagctggcgc
acagcagatgaggacagaggacctagacgtgggatggatgaggaccgggggccaagacga
ggtgctgatgatgaacggtcatcctggcgtaatgctgatgatgacaggggtcccaggagg
ggcatggatgatgaccggggtcccaggcgagggttggatgatgaccgaggaccttggagg
aatgctgatgatgataggatttccaggcgaggtgcagatgatgaccggggcccttggaga
aatatggatgatgatcggatttccagacggggtgatgatgcaagacctggtccctggaga
ccatttgtcaagccaggtggatggagagagaaagaaaaggctagagaagaaagttggggt
ccacctcgagaatcaagaccatcagaagaacgtgaatgggatagagacaaagagaaggat
agagagaaccaagatcgagaggagaatgacaaggaccttgaacgggaaagggacagagaa
agagatggagaccgggaggatcgcttcagaagacccagggatgaaggtggctggagaaga
ggaccagcagaagaatcttcaagctggagagattcaagtcgccgtgatgatagggacagg
gatgaccgtcgtcgggagagagatgatcgtcgtgatctgagagacctgagagaaagaagg
gatttaagagatgatagagaccggagaggaccccccctcagatcagagcgagaggaagca
agctcttggagacgtgcagatgacaggaaagatgaccggactgaagaacgggatctacct
cgtcgtgttcctcccacagctatttcaagagatagagaaagagagagagaacgagaaggt
gagaaagagaaagcatcctggagagctgagaaagatagggagtcccttcgtcgtactaag
aatgaaactgatgaagatggatggaccacagtacggcgctaa

DBGET integrated database retrieval system