KEGG   Mucilaginibacter sp. PAMC 26640: A0256_04050Help
Entry
A0256_04050       CDS       T04335                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mup  Mucilaginibacter sp. PAMC 26640
Brite
KEGG Orthology (KO) [BR:mup00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A0256_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMR30655
UniProt: A0A142HP47
Position
complement(928552..929562)
Genome map
AA seq 336 aa AA seqDB search
MVTTLLVAVVALALIFDYTNGFHDAANSIATIVSTKVLTPFQAVLMAAVFNFAAYFFIKD
HKVANTVAKIVVEQYITLHVILAGLIAAITWNLATWWFGIPSSSSHTLIGGFAGAGVCNA
IYLGAPALSAVNAHYILTIIAYIVLAPFIGLIIAYFITILILHICKKARPVTAERWFKRL
QLVSAAALSFAHGTNDAQKVMGILYVALIAAKIIGAGSPMPEWIPLACYTAISAGTMSGG
WKIVKTMGSKITKITPLEGVAAETAGAVTLFITERFGIPVSTTHTITGSIIGVGLTKRVS
AVRWGVTINLVWAWIITIPISALIAGLVFVLIHLIG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggttaccactttattagttgctgtagttgccctggcccttatatttgattataccaat
gggtttcatgatgcagcaaactctatagccaccatcgtatcaaccaaggtactaacgcct
ttccaggcggtgttgatggctgctgtatttaactttgccgcttacttttttatcaaagac
cataaggttgccaacacggtagcaaaaattgtggtagaacagtatatcacacttcatgtt
atccttgccgggcttatagcggcaattacctggaatttagctacctggtggtttggtatt
ccttccagttcatcccacacgcttatcggcgggtttgcaggtgccggtgtttgtaatgcc
atctacctgggtgcaccagctttaagtgcggtgaacgctcactacatcttaaccattatt
gcctatattgtactagcgccttttattggtttaattatcgcttattttattactatcctt
attctgcatatatgtaaaaaggccaggcccgtaacagccgaacgctggtttaaacgcctg
caacttgtttcggcagcggcattaagctttgcacacggtactaacgatgcacaaaaggta
atgggtattttatacgttgcgctgatagcagctaaaataatcggcgcaggttcacctatg
ccggagtggatcccacttgcctgttacactgcaatatctgcaggtaccatgagcggaggt
tggaagatcgtgaaaacgatgggatctaaaataaccaagattactccgctggaaggtgtt
gctgcagaaactgccggtgccgttactctatttatcaccgagcgttttggaatacctgtt
tctactacacacactattacgggttctattatcggggtaggcttaaccaagcgcgtatct
gctgtgcgctggggcgtaactataaatttggtttgggcatggatcattaccattcctatt
tctgcactaattgccggtttggtatttgtgctgatccacttgataggttaa

DBGET integrated database retrieval system