KEGG   Muriicola sp. MMS17-SY002: EQY75_07480Help
Entry
EQY75_07480       CDS       T05825                                 

Definition
(GenBank) HAD family phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
mur  Muriicola sp. MMS17-SY002
Pathway
mur00010  Glycolysis / Gluconeogenesis
mur01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EQY75_07480
Enzymes [BR:mur01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     EQY75_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: QBA64382
UniProt: A0A411E9K9
Position
1656343..1656945
Genome map
AA seq 200 aa AA seqDB search
MIKNILFDFGDVFINLDKGATLRELSEAGYDVIAAELYPLMISYEKGLLPTSEFVKSAQY
YFPGLETMDLISAWNAIILDFPEDRLTFLKQLAARENYRLFLLSNTNDLHITKVKKEMGE
KKFNAFRKCFEGFYLSHELKMRKPDAEVFLTILENHSLKPNETLFVDDTLEHIVSADRLG
LKTWHLQVGKEAVTDLDKHL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaatatcctctttgattttggagatgtctttatcaacctggacaagggtgcc
actttaagggaattgtcagaagcggggtacgatgtgatagcagcagaactttacccactt
atgattagctatgaaaaaggacttttgccaacttctgaatttgttaagtcggcacaatat
tactttcctggactggaaaccatggatttgatctcggcctggaatgcgataattctggat
ttccctgaagaccggctcacatttttaaaacagctggcagccagggagaattacagactc
tttttattgagtaacaccaacgatttacatatcacaaaagttaaaaaggagatgggagaa
aaaaaattcaatgccttcagaaaatgcttcgagggtttttacctttcccatgaattaaaa
atgcgaaagcccgatgctgaggtctttttgaccatattggaaaatcactctttaaagccc
aatgaaaccctcttcgtagacgatacgcttgaacacattgtcagtgccgataggttggga
ttgaagacctggcatttgcaggtgggaaaggaagcagtaacagacctcgataagcatttg
taa

DBGET integrated database retrieval system