KEGG   Musa acuminata (wild Malaysian banana): 103969586Help
Entry
103969586         CDS       T03447                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 27-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mus03041]
    103969586
   03009 Ribosome biogenesis [BR:mus03009]
    103969586
Enzymes [BR:mus01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103969586
Spliceosome [BR:mus03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    103969586
Ribosome biogenesis [BR:mus03009]
 Eukaryotic type
  90S particles
   Helicases
    103969586
  Pre-60S particles
    103969586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII SWI2_SNF2
Motif
Other DBs
NCBI-GeneID: 103969586
NCBI-ProteinID: XP_009381440
Position
10
AA seq 583 aa AA seqDB search
MSPVMELHDVKRQKKPNKKRKNRPIPQVDADATGAEGGGLAVDEEDHHEEKSLKGLGEEQ
EVVKEEMDGDQVGDGAEMTAPAVKKKKKDYGILTSESFSRLPISELTMKAIQEMGFENMT
QIQSRAIPPLLEGKEVMGAARTGSGKTLAFLIPAVELLHNIHFMPRNGTGIIIICPTREL
AIQTHAVAKDLLKYHSQTLGLVIGGAGRKGEAEHLAKGVNLLVATPGRLLDHLQNTKGFI
YKNLMFLIIDEADRILEANFEEDMKQIFKRLPKARQTALFTATQTKQVEDFACLSFKEKP
IYVGVDDGRSKVTVEGLQQGYCVVPSNKRFMVLYAFLKRNLSKKIMVFFSSCNSVKYHSE
LLRYIQIDCLDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPP
DEPKEYIHRVGRTARGEGGKGNALLFLLPEELQFLLYLKEAKVPVKEYEFNEKKVPNLQS
HLEKIVGENYYLSQSAKDAYRSYILAYNSHSMKNVFNVHHLNLKDVAASFCFSSPPKVNL
DLESSASKFRKKMRKTEGSRHGISASNPYGKQKGDDKRQFARY
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgtctccggtcatggagcttcatgacgtaaagaggcagaagaagcccaacaagaagagg
aagaacaggccaatcccccaggtagacgcggacgccaccggtgctgaaggtggcggactg
gcggtggacgaagaagaccaccacgaagagaagtcgctcaagggtttaggtgaggagcag
gaggtggtcaaggaagagatggacggagatcaggtcggcgacggcgcagagatgacggct
cccgccgttaagaagaagaagaaggactatggaatattgacttcggagtccttctctcgg
ctccccatctccgaactcaccatgaaggccatccaagagatggggtttgaaaacatgacg
cagattcaatctagggctattccgcctttgctggaagggaaagaagtgatgggtgctgca
aggacgggttcaggaaaaactcttgcttttttgatacctgcagtcgagttgctgcataat
atccattttatgcctcggaatggtactgggatcatcattatttgtccgacgagggagctt
gccattcaaacacatgccgttgcaaaggaccttttgaagtaccattcacagactctaggt
ttggttattggtggtgctggacgaaaaggagaagctgagcatcttgctaagggagtaaat
ttgttggtggctacgcctggaagactcttggaccatcttcaaaacaccaaaggatttatt
tacaaaaatttgatgtttcttataattgatgaagctgatcgaattttggaggctaacttt
gaggaagatatgaagcaaatatttaagcgcctgccaaaggcaaggcaaactgctcttttt
actgctacccagactaagcaggttgaggattttgcgtgtttgtcatttaaggaaaagcca
atatatgttggagttgatgatgggaggtcaaaagtcacggtagaaggtttgcagcagggg
tactgtgttgttccaagtaacaaaaggtttatggtcttgtatgcttttttgaaaaggaat
ctttcaaaaaagataatggtcttcttttcttcctgcaactctgtcaagtaccactcagag
cttctcagatacattcaaattgattgccttgatatccatggaaagcaaaagcagcagaaa
cgtacgacaaccttttttgacttctgcaaggcagaaaaagggatcctactctgcactgat
gttgctgctcgtggacttgatattcctgctgtggactggattgtgcaatatgatcctcct
gatgaacctaaggagtacatccacagggttggtcggacagctcgtggagaaggtggcaaa
ggcaatgcattgctttttctgttgcctgaagagttgcaattccttctttatttgaaggaa
gccaaggtacctgtcaaagaatacgagtttaatgaaaagaaagtgccaaatttgcaatct
cacctggagaaaatagtgggagaaaactactatttaagccagtcagctaaagatgcgtat
aggtcctatattttagcctacaattcacattctatgaagaatgtgtttaatgtgcaccac
ctcaatctcaaggatgtggctgcatcattttgctttagctcgcctccgaaggtgaatttg
gacttggaaagcagtgcgtccaagttcaggaagaaaatgcgcaaaactgaaggcagccgc
cacggtatcagtgcaagtaatccctatggaaaacagaagggtgatgacaaaagacagttt
gcacgatactaa

DBGET integrated database retrieval system