KEGG   Musa acuminata (wild Malaysian banana): 103969768Help
Entry
103969768         CDS       T03447                                 

Definition
(RefSeq) glutathione S-transferase zeta class
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00350  Tyrosine metabolism
mus01100  Metabolic pathways
Module
mus_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103969768
Enzymes [BR:mus01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     103969768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 103969768
NCBI-ProteinID: XP_009381693
Position
10
AA seq 284 aa AA seqDB search
MWTNVKNVFNNNPPAAATAASGIMATASAVVSSSPRSSEPVSIRANFSPFLLSSSPFLFQ
ESASCPKKLTLYSYWRSSCSHRVRIALNLKGLDYEYKAVDLSKGEQFDPEFEKLNPVRFV
PVFVDGDVVVADSFAIILYLEDEHPQFPLLPRDLKKKALNLQVANIISSSIQPLQMLSVL
NFIEEKISSDEKVAWAQRHINNGFTAIEKLLEGSAGKYASGDKVQLADVFLAPQIYVGVT
RFQIDMSQYPTLARIYEAYAELPAFQAAHPNRQPDAFPSSSQSC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtggactaatgtgaaaaatgttttcaacaacaacccacccgccgcggccaccgccgct
tctggaatcatggcgaccgcttcagcggtagtaagctcgtcgccccgctcttcggaaccg
gtctctattcgtgctaatttctctccatttcttctaagttcgtctccttttctcttccag
gaatccgcctcgtgcccgaagaagctgacgctctactcctactggcggagctcctgctcg
caccgagtccggatcgcgcttaatctcaaagggttggattacgagtacaaggccgtggat
ctatccaagggcgagcagttcgatccagaattcgagaagcttaatccagttaggtttgtg
cctgtatttgtggatggtgatgtagtagttgcagactcgtttgctatcatattgtattta
gaagacgagcaccctcaatttccactgctgcctcgagatctgaaaaagaaagccctcaat
ctccaggtagcaaatatcattagttcaagtatccagccacttcagatgctttctgtattg
aatttcattgaggaaaaaatcagttctgacgagaaagttgcatgggctcagcgtcacatc
aacaatggattcactgcaatagaaaaattgttagaaggctctgctgggaaatatgcttca
ggagacaaagtacaactggcagacgtgtttctggcacctcagatatatgtcggagtaaca
cgtttccagattgatatgtctcagtaccctacgttagccagaatctatgaagcgtatgct
gaactgcctgcattccaagctgcccatccgaacaggcaaccagatgcatttccttcatct
tcacaatcatgttga

DBGET integrated database retrieval system