KEGG   Musa acuminata (wild Malaysian banana): 103970427Help
Entry
103970427         CDS       T03447                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase 4, chloroplastic
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00030  Pentose phosphate pathway
mus00480  Glutathione metabolism
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
mus01200  Carbon metabolism
Module
mus_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mus_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    103970427
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103970427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mus04147]
    103970427
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     103970427
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     103970427
Exosome [BR:mus04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   103970427
  Exosomal proteins of colorectal cancer cells
   103970427
  Exosomal proteins of bladder cancer cells
   103970427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 103970427
NCBI-ProteinID: XP_009382478
Position
11
AA seq 613 aa AA seqDB search
MPVLLPSSATTEAHAMVSVSSSIARPSSVRLLPLPAPRFPPVASKCFFHCAASGTTTRVC
ELKIWMLEKLKWRKNFRTHGWEKKPRMLQVQDSVEETTSNSEVAESSPPNVQPIIPKYLE
SSMESSSSSAYGNSVDRVPSLCIAVVGATGELARNKIFPALFALYYSGFLPENVGIFGYS
RKDLSDEDLRNIVAATLTCRVDHHENCGDKLDAFLDRTYHINGGFNNKDGMKMLNRRMEQ
IEGEHEANRIFYLSVPQEALLDVSVSLADNSQTKRGWNRIIIEKPFGFDALSSHKLTQCF
LSKFQEKQLYRIDHRLGKDLIENITVLRFSNLVFEPLWSRTYIKNVQVIFSEECGMEAQG
RYFGHYGVIRDIVHSHILQTIALFAMEPPVSLDGEDIRNEKVKVLRSIRKLNLDDVVLGQ
YKNSADKSSCYMNSLTPTFFAAALYIDNARWDGVPFLVKTGVGLIKHRVEIRIQFHHVPG
NLYRECISHNIDLTTNELILRDQPDEAILLKVNNKVPGLGLQLDASELNLLYRDKYNVEV
PDSYEHLLLDVIDGDNHLFMRSDELEAAWNILTPILDKIEENKVVPELYEIGGRGPVGAY
YLGANHGVRWADD
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcctactcccgtcgtccgctacgaccgaggcgcacgccatggtctccgtgtct
tcatcgatcgcgcggccctcctccgtacgacttctcccgctccccgcccctcgctttcct
cccgttgcatcaaaatgcttcttccattgtgctgcttctggtaccaccactagagtttgt
gaattaaagatttggatgcttgagaagcttaaatggcggaagaatttcagaacacatgga
tgggaaaagaagcccaggatgcttcaagtccaagattcagttgaagaaacaacatcaaat
tctgaagttgcagaaagttctcctcctaatgttcagccaattattcctaaatatcttgag
tcttccatggaatcttcctcatcttctgcttatggaaattcagttgatagagtaccctct
ctttgtatagctgttgtaggagctactggtgaacttgcaagaaacaaaatatttccagca
ttatttgccctgtattatagtggttttcttccagagaatgtgggcatttttggatattct
agaaaggacttgtcagatgaggatctaagaaacatagttgcagcaactttgacttgtcga
gttgatcatcacgagaactgcggggataagttggatgcctttcttgatagaacatatcat
ataaatggaggatttaacaacaaagatgggatgaaaatgcttaataggcgaatggagcaa
attgagggtgaacatgaagcaaacaggatattctacctttcagttccccaggaagcactt
cttgatgtttcagtttctcttgctgataattcccaaacaaaaagaggatggaacaggata
atcattgagaagccatttggctttgatgcattatcttcacacaagctcacacagtgcttt
ctgtcaaagtttcaagagaagcagctgtataggattgatcatcgcctggggaaggaccta
attgagaatatcactgtattgaggttctctaatctggtttttgaaccattatggagtcgg
acttacataaaaaatgtgcaagttatcttttcagaagaatgtggcatggaggcacaagga
agatactttggtcactatggtgttatccgtgacatagttcatagtcacattcttcagaca
attgctttatttgctatggaaccacctgtgagtctcgatggggaagacatacgaaatgaa
aaggtcaaggtgctcagatctatcagaaagttgaatctcgatgatgttgttcttggccag
tataaaaatagtgcagataaaagtagttgttacatgaactccctgacgcctacatttttt
gctgctgctctgtacattgacaatgcacgctgggatggtgtgcctttcttagtaaagact
ggagtgggccttattaaacacagagttgaaataaggatccagtttcaccatgtccctggc
aatttgtaccgtgaatgcattagccacaacattgatctcacaacaaacgaactgatccta
cgggatcagccagatgaagcaattctgttaaaggtcaataataaggttcctggactcggg
ttgcagctggatgcttctgagttaaacttgctctaccgggataagtacaatgtggaagta
cccgattcatatgagcaccttcttctggatgtaattgatggagacaaccatctctttatg
cggagcgacgagttggaagctgcatggaacatactaaccccaattctcgacaaaattgaa
gagaacaaagtggtgccggagctctatgagattgggggtcggggacctgttggcgcttat
tatcttggtgccaatcatggagttcgttgggctgatgactaa

DBGET integrated database retrieval system