KEGG   Musa acuminata (wild Malaysian banana): 103970496Help
Entry
103970496         CDS       T03447                                 

Definition
(RefSeq) probable nucleolar protein 5-2
  KO
K14565  nucleolar protein 58
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    103970496
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mus03009]
    103970496
Ribosome biogenesis [BR:mus03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    103970496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 103970496
NCBI-ProteinID: XP_009382561
UniProt: M0RPQ9
Position
11
AA seq 585 aa AA seqDB search
MLVLFETPAGFALFKILDEGKLDKVEDLWKEFATSESARKIVKLKAFNKFENTSDALSAA
TLLIDSKPSKGLRKFLRTHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ
LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR
VREWYGWHFPELAKIVQDNIQYAKVVKLMGNRTNAVNLDFSEVLSEETEAELKEAAVISM
GTEVSDLDLANIKELCDQVLALSEYRAQLYDYLKSRMNTIAPNLTALVGELVGARLIAHG
GSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIFHASLIGQAAPKIKGKISRSL
AAKTALAIRYDALGDGQDNTMGLENRAKLEARLRVLEGRELGRSAGSTKGKPKIEFYDKD
RKKGAGALITPAKTYNPSADLVFGQTTDLAPSKQAAEQEATLRKKRKHEEAELEPTGEAS
EDPPKEEGEGEGEKRKKKKKKIELGSADDQISISEAEEQTKKKKKKKKDKAPGPELVNQD
NIAAPESEEELSKKKKKKKKQAEEEQAAGDASNRKKDKKKKDKGL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgttggttttgttcgaaacccctgcgggttttgccttgttcaaaattttggatgaaggg
aagctggacaaagttgaggatttgtggaaggaatttgctacctcagaatcggctagaaag
attgtaaagttgaaagctttcaataaatttgagaacacttcagatgcattatccgctgca
accttattgattgatagcaagcctagcaagggcctccggaagtttctacgtactcactgt
gatggtgaaaccttggccgtggctgattcaaaacttggaaacgcaattaaagagaagctg
aaaatagactgtctccacaacaatgctgtaatggagctaatgagaggactaaggaaccag
ctgacagaacttatatctgggttggccgtgcaagatttagctccaatgagcttgggattg
tcacacagcctatctaggtacaagctgaaattcagccctgataaggtggatacaatgatt
attcaagccataggtttgttggatgatcttgacaaagagctcaatacctatgccatgaga
gtccgtgaatggtatggatggcattttccagagcttgctaagattgtacaagacaatatt
cagtatgcaaaggtagttaagctgatgggaaaccgtacaaatgctgtcaatcttgatttc
tctgaggtactgtctgaagagactgaagcagagctgaaggaagcagcagttatatcaatg
ggaactgaagttagtgatctagacttggcaaatattaaagaactatgcgatcaagttcta
gctctttcagagtatagagctcaactttatgattaccttaaaagcagaatgaatacaatt
gcgccaaatttgactgctcttgttggtgagcttgttggagctcgtcttattgctcatggt
ggtagcttattgaatctagcaaagcaaccgggtagcacagttcagattcttggagcggaa
aaggctctgttcagagctctcaagacaaaacatgctacaccaaaatatgggcttatcttc
catgcatcactaattggtcaggcagcaccaaaaatcaaaggaaagatttctcgttctctt
gctgcaaaaactgctttggctattagatatgatgctcttggggatggtcaagacaacact
atgggactagaaaatcgagctaagcttgaagcccgccttagggttcttgagggcagagaa
ttgggtcgttctgctgggtcaacaaaaggaaagcccaagattgagttttatgacaaagat
cgaaagaagggtgcgggggctctgattactccagcaaagacatataatccttcagctgat
cttgtgtttgggcaaaccactgatctagctccaagcaagcaagccgctgaacaggaagca
acacttagaaagaagaggaagcatgaggaagcagaactggaacccactggagaagcttct
gaagaccctcctaaagaggagggcgagggtgaaggggagaaaaggaagaagaagaaaaaa
aagattgagttaggaagcgctgatgatcaaatttccatcagtgaagcagaagagcagaca
aaaaagaagaaaaagaaaaagaaggataaagctccgggccctgagttagtgaaccaagat
aatattgctgctcctgaatctgaagaggagctttccaaaaagaaaaagaagaagaaaaag
caggctgaagaagagcaagctgcaggtgatgcatcaaacaggaaaaaggacaagaagaaa
aaagacaagggcctgtga

DBGET integrated database retrieval system