KEGG   Musa acuminata (wild Malaysian banana): 103971057Help
Entry
103971057         CDS       T03447                                 

Definition
(RefSeq) cyclin-dependent kinase B1-1
  KO
K07760  cyclin-dependent kinase [EC:2.7.11.22]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mus01001]
    103971057
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     103971057
Protein kinases [BR:mus01001]
 Serine/threonine kinases: CMGC group
  CDK family
   103971057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 103971057
NCBI-ProteinID: XP_009383275
UniProt: M0RR31
Position
11
AA seq 303 aa AA seqDB search
MEKYEKLEKVGEGTYGKVYKAQDKATGQLVALKKTRLEMDEEGIPPTALREISLLQLLSR
SIYIVRLLNVEQVEKNGKPLLYLVFEYLDTDLKKFIDSHRRGTNPRSIPSPVIQSFLYQL
CKGVAHCHSHGVLHRDLKPQNLLVDKEKGILKIADLGLGRAFTIPLKSYTHEIVTLWYRA
PEVLLGTTHYSTGVDIWSVGCIFAEMVRRQSLFPGDSELQQLLHIFRLLGTPTEEQWPGV
GSLRDWHAYPQWKPQNLARAVPALEPEGVDLLSKMLQYDPANRISAKAAMEHPYFDSLDK
SQF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtacgagaagctggagaaggttggggaagggacgtatgggaaggtgtacaag
gcgcaggacaaggccacggggcagctcgtcgccctcaagaagactcgcctcgagatggac
gaggagggcatcccccctaccgccctccgcgagatctcactcctccaactcctatcccgc
tccatctacatcgtccggttgctgaatgtggagcaagtagagaaaaacggaaagccgctg
ctttatctggtgttcgaatacttggatactgatctcaagaagttcatcgactctcatcgc
aggggaacaaaccccaggtcgatcccctccccagtcattcagagctttttgtatcagttg
tgtaagggagttgcacattgtcatagccatggcgtgctccacagggacctgaagcctcaa
aatctcttggtcgataaagagaagggcatcttgaagattgctgatcttgggctgggaaga
gccttcacaatccctttgaagagttacacacatgagattgttactctctggtatagagca
cctgaggtcttgttgggaacaacccactactcaactggagtggatatatggtctgtagga
tgtatctttgctgaaatggtgcgaagacaatctctttttcctggtgattccgagttgcag
cagttacttcacatcttcaggctgttagggactccaactgaagagcaatggcctggagtt
ggctcgctgcgggattggcatgcctatccacaatggaaacctcagaacttggcacgtgca
gttccagcactggaacctgaaggcgttgatcttttatcgaaaatgcttcaatacgaccca
gctaacagaatctcagctaaagcagcaatggagcacccctactttgattccctggacaag
tcacaattctag

DBGET integrated database retrieval system