KEGG   Musa acuminata (wild Malaysian banana): 103973142Help
Entry
103973142         CDS       T03447                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase-like
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     103973142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 103973142
NCBI-ProteinID: XP_009385909
UniProt: M0U6C2
Position
Unknown
AA seq 703 aa AA seqDB search
MQSESAKPSPLDLLSAILAGSLGGDGLPSGAGSLAAIAENRQLLAIVTTSVAVLVGCALI
FFFRRSSGKKPAEPPKPLVVRVLPELEVDDGKKKVTVFFGTQTGTAEGFAKALTDEAKAR
YQNAIFKVVDLDEYAADDDEYEEKMKKETLAVFFLATYGDGEPTDNAARFYKWFTEGKER
GNWLDNLQFAVFGLGNRQYEHFNKVAKVVDEMLAEQGGKRVVPLGLGDDDQCIEDDFTAW
REILWPELDQLLRDENDVSGASTPYAAAVPEYRVVFFNPEETSSLDKSWNLANGHAIHDI
HHPCRANVAVRRELHTPASDRSCIHLEFDIAGIGLTYETGDHVGVFTENCVETVEEAERL
LGYSPDTYFSIHTDKEDGTPLGGSLSPPFPSPCTLRNALTLYADLLNSPKKSALVALAAH
ASDPIEAERLRFLASPAGKDEYSQWIVACQRSLLEVMAEFPSAKPPLGVFFAAISPRLQP
RYYSISSSPRMAPTRIHVTCALVYEKLPTGRIHKGVCSTWMKNSIPLVESQECSWAPIFV
RQSNFKLPADPSLPIIMIGPGTGLAPFRGFLQERLALKEAGVELGHAILFFGCRNRKMDF
IYEDELNNFVETGALSELIVAFSREGPTKEYVQHKMTEKASDVWNIISQGGYVYVCGDAK
GMARDVHRVLHTIVQEQGSLDSSKTESFVKSLQMEGRYLRDVW
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcggaatccgcgaagccctctccgctcgatctcctgtcggccatcctcgccggc
tccctcggcggcgatgggctcccctcgggagccggatccttggcggcgatcgccgagaac
cggcagctcctcgcgatcgtcaccacatcggtcgcggtgctcgtcgggtgcgcgttgata
ttcttcttccggcgatcgagcggaaagaagccagccgagccgccgaagcctctggtggtg
agggtactgccggagttggaggttgacgacgggaagaagaaggtcactgtcttcttcggc
acgcagactgggacggccgaggggttcgctaaggctttgacggacgaggctaaggcgcga
taccagaatgcgatatttaaagttgttgatctcgacgaatatgctgctgacgatgacgag
tacgaggagaagatgaaaaaggagaccttagctgtgttcttcttggccacgtacggagat
ggggagcctactgataatgctgcacggttctacaaatggtttacagaggggaaagagaga
gggaattggttagacaatcttcagtttgctgtgtttggtttaggcaaccggcaatatgag
catttcaataaggttgctaaggtggttgatgaaatgctcgctgaacaaggtgggaagcgt
gttgttccattgggtctgggtgatgatgatcagtgtatcgaggatgacttcactgcatgg
agggagattctctggccagaactggatcagttgcttcgggatgaaaatgatgtttcaggt
gcatctaccccatacgcagctgctgttccagaataccgggttgtctttttcaaccctgaa
gaaacttcttccctggacaagagttggaatcttgcaaacggccatgctattcatgatata
catcacccatgcagggctaatgtggctgtgcggcgggagcttcatactccagcttcagat
cggtcctgtatccatttggagtttgatattgctggcattggtcttacgtatgaaacggga
gatcatgttggtgtattcacagagaattgtgttgagactgtagaggaggctgaaagactg
ttaggttattcgccagatacgtatttctcaatccacactgacaaggaggatggcacacca
cttggaggctctttgtcgcctcctttcccgtctccatgcaccttaagaaatgcacttact
ctatatgctgatcttctaaattcacccaaaaagagtgcattagttgccttagctgcacat
gcttcagatcccattgaagctgagcgacttagatttttggcttctcctgctggaaaggat
gaatattctcaatggatcgttgcttgtcagagaagtcttctagaagttatggctgaattc
ccttctgcaaaacctccattgggagtcttctttgctgcaatctccccccgcttgcagcct
agatattattcaatatcatcttctccgaggatggcaccaaccagaatccatgtgacatgt
gcgctagtgtatgagaagttaccaactgggaggattcataaaggagtctgttcaacttgg
atgaagaattctattccattggtagagagccaagaatgcagctgggctcctatatttgtg
agacagtcgaactttaaactgcctgcagatccttctctacctattattatgattggtcca
ggcacagggttggcacccttcaggggcttcttgcaggaaaggttggcattgaaagaagct
ggtgtggaacttggtcatgctattctcttctttggatgcaggaaccgcaaaatggacttc
atctatgaggatgagttgaataatttcgttgaaacaggtgcactttctgaattgattgtt
gccttctctcgtgaaggcccaaccaaggaatatgtgcagcataaaatgactgaaaaagca
tctgatgtttggaatatcatctcccaaggtggttatgtgtatgtgtgtggtgatgctaag
ggtatggctagagatgttcacagagttcttcatactatcgtccaggagcagggatctctt
gatagttccaagacggagagttttgtgaagagccttcaaatggaagggagatatctgagg
gatgtgtggtaa

DBGET integrated database retrieval system