KEGG   Musa acuminata (wild Malaysian banana): 103976140Help
Entry
103976140         CDS       T03447                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00520  Amino sugar and nucleotide sugar metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103976140
Enzymes [BR:mus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103976140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 103976140
NCBI-ProteinID: XP_009389617
Position
2
AA seq 438 aa AA seqDB search
MGSELTYRGREALPADDAGANSPKPEKRFLCLPRPLRYLLSEQRLLFVLVGVALASVFFV
FAPPYTGPSTAGAHLAVDLARLSSMPAVHGGYRMALERRFVGGRVPLGLKRKGLRIVVTG
GAGFVGSHLVDRLIERGDSVIVVDNFFTGQKENVMHHLGNPNFELIRHDVVEPLLLEVDQ
IYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLQHPQV
ETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAQLEVRIARIFNTYGPRMCIDDGRVVS
NFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLIKLMEGENVGPFNLGNPGEFTMLELA
KVVQDTIDPNAKIEFRPNTADDPHKRKPDITRAKELLGWEPKVSLSDGLPLMVTDFRKRI
FGDQADNNPTTTADSRSI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgagctcacctaccgcggccgcgaagccctgccggcggacgacgccggggcg
aactcccccaagcccgaaaagaggttcctttgcctgccccgcccgctccgatacctcctc
agcgagcagcgcctcctcttcgtgcttgtcggcgtggctctggcctccgtgttcttcgtc
ttcgctcctccctacaccggcccttccaccgccggtgcccacctcgcggtggacctcgcc
cggttgtcgtcgatgccagcggtgcatggcgggtaccggatggcgctcgagagaaggttc
gtcgggggaagggtgccgctgggactgaagcggaaggggctccgcatcgtggtcaccggg
ggcgccgggttcgtggggagccatctggtggaccgcttgatcgagagaggggacagcgtc
atcgtggtggacaacttcttcacggggcagaaggagaacgtgatgcaccacctcgggaac
cccaacttcgagctcatccgccatgacgtggtggagccgctactcttggaggtggatcag
atctaccaccttgcgtgtccggcgtcgccagtccactacaagttcaatcctgtgaagacg
atcaagaccaatgttgtgggaactctcaacatgctgggcctggccaagagagtaggagcc
agatttctcctcacaagcaccagtgaggtttatggtgatcccttgcaacacccacaagta
gagacctactggggcaatgttaatcccatcggtgttaggagctgctacgacgaaggcaag
cgaactgcagagactttgaccatggattaccatcgtggtgcccaacttgaggtgagaatt
gctcgtatcttcaacacttatggacctcggatgtgcattgatgatggtcgcgttgtgagc
aattttgttgcccaggccttgaggaaggagccattgacagtttatggggatggaaagcaa
accaggagctttcagtatgtctctgatctggtggaggggctgattaagttgatggagggt
gagaatgtcggtccattcaacctggggaaccctggagaattcaccatgctggagcttgca
aaggtagtgcaggatacaattgaccccaatgccaagatagaattccgaccaaacacagca
gacgatccccacaagcgcaaacctgacatcacacgagccaaagagctacttggctgggaa
ccaaaggtctccctcagtgatggcctccctctcatggtcactgatttccgcaagcgtatc
tttggtgaccaagctgacaacaatccaaccaccaccgctgacagcagatccatctaa

DBGET integrated database retrieval system