KEGG   Musa acuminata (wild Malaysian banana): 103978301Help
Entry
103978301         CDS       T03447                                 

Definition
(RefSeq) probable serine/threonine-protein kinase NAK
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mus01001]
    103978301
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103978301
Protein kinases [BR:mus01001]
 Serine/threonine kinases: TKL group
  IRAK family
   103978301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH
Motif
Other DBs
NCBI-GeneID: 103978301
NCBI-ProteinID: XP_009392329
Position
3
AA seq 421 aa AA seqDB search
MGNCVWPSSRSASPADTTPTSPGRSTPKTGSSTTTTGKLSSPSSSSTFGQSTGSSSASID
EVFPDGRILEAPNLRIFSFAELRTATRNFKPEMVLGEGGFGKVYKGCVEEKTLNPAKSGV
GIVVAVKKLNPESMQGLEEWQSEVNFLGRLSHPNLVKLMGYCWEKELLLVYEYMPKGSLE
NHLFRRGAAFEPLSWSIRLKIAIGAARGLAFLHSSEKQVIYRDFKASNILLDANYNAKLS
DFGLAKHGPTGSDSHVTTRVMGTYGYAAPEYVATGHLYVKSDVYGFGVVLLETLSGQRTL
DPNRPSGQHNLVDWARPMLADRRKLARLMDPRLEGQYSSKGALQAAQLTLRCLAGDPKSR
PSMKEVVETLEHVEAIKRGSREPRNTPQRSVAAEAPCRAHGRAAPPLHPGGGAARQPHSA
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgcgtttggccttcctcaagatctgcaagtcctgcagataccacaccaacc
agtccagggcggtcgacacccaagacgggcagtagcaccacaaccaccgggaagctgtcg
agccccagcagcagcagcaccttcgggcagtccaccggcagcagcagcgcgagcattgat
gaggtgtttcccgatggccggatcctggaggcgcccaacctccggatcttttccttcgcc
gagctgaggaccgccaccaggaacttcaagccggagatggttctcggagaaggcggattc
gggaaggtgtacaaggggtgcgtggaggagaagaccctgaaccctgccaagagcggcgtg
gggattgtggtcgccgtgaagaagctgaaccccgagagcatgcaagggctggaggaatgg
cagtctgaagtaaatttcctggggaggctgtcacacccaaacctcgtcaagctgatgggg
tactgctgggagaaggagctcctcctcgtgtacgaatacatgcccaagggaagcttggag
aaccacctcttccgaagaggagcagcgtttgagccactctcttggagcataaggctaaag
atcgccattggagcagctcgaggcctcgcgttcctgcactcttcggagaagcaggtcatc
taccgcgacttcaaggcctccaacatcctcctcgacgcgaactacaacgccaagctctcc
gatttcggcctcgcgaagcatggcccgaccggcagtgactcacatgtcaccacgcgcgtc
atgggaacctacggctatgcggcaccggagtacgtcgccactggtcatctgtatgtgaag
agcgacgtgtatggattcggagtcgtgctgctggagacgctctccggccagagaacactg
gaccccaaccggccgagcgggcagcacaacttggtggactgggcaaggccgatgctggcc
gaccggaggaagctggcgcgactgatggacccgcggctggaggggcagtactcctctaag
ggggctctgcaagcggcgcagctcaccctgcgatgcctcgcgggcgacccgaagagccgc
ccgtccatgaaggaagtggtggagacgctggagcacgtcgaggcaataaagagggggtcg
agagagcccagaaacaccccccagcggtcggttgcggccgaggctccctgccgcgcccat
ggccgggccgctccgccgctgcaccccggcggcggcgctgctcggcagccccacagcgcg
agatga

DBGET integrated database retrieval system