KEGG   Musa acuminata (wild Malaysian banana): 103978617Help
Entry
103978617         CDS       T03447                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00010  Glycolysis / Gluconeogenesis
mus00020  Citrate cycle (TCA cycle)
mus00620  Pyruvate metabolism
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
mus01200  Carbon metabolism
Module
mus_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103978617
   00020 Citrate cycle (TCA cycle)
    103978617
   00620 Pyruvate metabolism
    103978617
Enzymes [BR:mus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103978617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl DUF2457
Motif
Other DBs
NCBI-GeneID: 103978617
NCBI-ProteinID: XP_018678783
Position
3
AA seq 328 aa AA seqDB search
MVMDDAVIFIESMDIGESVVVVELDKADMDVETFYDGYLAAIMVEEGAVAPVGSANALLA
ESQDENPLAKTQASSSSATGVSASPPPAQAPASPPLRTVASPKPSPAAASSSTHSASDGG
QRXYAMKLAKDLKLDLTGLSGTGPMGRIVAKDVEIAAASAAAMRIAPPKVTVESQLAKSP
TSPAIELGTVVPFTTMQGAVIENMVDCLSLPTFXGGYTITTNVLDDLYKKTKSKGCHHDC
IASKGYCCCRDGKSFIYNSSINIAVAVAIDGGLITPVLQGADEVDIYSLSRKWKELVDKG
RPKQLQPHEYNTVCRYIYSFKPWDVWCF
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggtaatggatgatgcagttatcttcattgaatcaatggatattggcgagagcgtcgtc
gtcgtggagctcgacaaggcggacatggacgtcgagaccttctacgacggctacctcgct
gcaattatggtcgaagagggtgccgtggcccccgtcggctccgccaacgccctcctcgcc
gagtcccaggacgagaacccccttgctaaaacccaagcctcctcctcctccgccactggc
gtttccgcttctcctcctcccgctcaagcacccgcctctcctcccctgcgaaccgtagcg
tctccgaaaccctcgccggcggccgcttcttcttcgactcactcggcgtcggacggtggg
cagcggnnatacgctatgaagcttgctaaggatctaaagttggacctgactgggttgtct
ggaaccggaccaatggggagaatcgtggccaaggatgtggaaattgccgctgcaagtgct
gcagccatgcggatcgctccaccgaaggtcacagtggaatctcaattggcgaagtctcct
acttctccagccatcgaattgggcactgtggttccattcaccacaatgcagggtgctgtt
atcgaaaacatggtcgattgcctctcacttccgacgttcntgggtggttatacgatcaca
acgaatgtccttgatgatctttacaagaaaactaagtcaaaggggtgccaccatgactgc
attgctagcaaaggctactgttgctgcagagatggtaaaagctttatctacaacagcagc
atcaacattgctgttgctgtggccattgatggagggttaatcacaccagtccttcagggt
gcagacgaggttgatatctactcattgtcaaggaaatggaaggaattggttgacaaagga
agaccgaagcagctgcaacctcatgagtataacactgtctgcaggtacatttactctttc
aaaccttgggatgtttggtgtttttga

DBGET integrated database retrieval system