KEGG   Musa acuminata (wild Malaysian banana): 103979067
Entry
103979067         CDS       T03447                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00100  Steroid biosynthesis
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
Module
mus_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103979067
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103979067
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 103979067
NCBI-ProteinID: XP_009393365
Position
3
AA seq 369 aa
MEVEAILAGLIPSWSSVVLLSCYLGYLAVAGSVLPGKIVPGALLSDGSRLHYRCNGLASL
LLLVALLEIGIYMKLMSAVVIADKGLELLSATFIFSLFVSLVLYAAGLKSRSQSSSLKPH
VTGDFIHDWWFGVQLNPHFLGIDLKFFFVRAGMMGWLLINLSLLAKNYEAGTANLSVILY
QLFCTLYVLDYFFYEEFMTSTWDIIAEKLGFMLVFGDLVFIPFTFSIQGWWLLKNKVELT
KVAAVANCLVFLVGYRVFRGANKQKHIFKKDPKAPIWGKAPKVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSAIPYFYPTYLLILLIWRERRDEARCSQKYKEIWAEYCQLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggaagtggaagccattctcgccggtctgatcccttcttggagctccgtcgttcttctt
tcgtgctatttggggtatttggctgtcgccggatccgtgcttccgggaaagatcgtcccc
ggcgcccttctatcagacggctcacgtctccattaccgatgcaacggtttggcatcactt
ttgctgttagtggcacttctagagattggtatttacatgaagttgatgtctgccgtggtc
atagcagacaaaggacttgagttgctatcagcaacttttatattcagcctctttgtttcc
ttggtactatatgctgctggccttaagtcacgtagccagagctcttctttaaaacctcac
gtcacaggagactttattcatgactggtggtttggagtacaacttaatcctcatttcttg
ggaattgacctcaaattcttctttgttagagctggaatgatgggttggttgctaatcaat
ctctctctgttggcaaagaactatgaagctggcactgcaaacctttcagttattctttac
cagctattttgcacgttatatgttttagattatttcttctatgaggaattcatgacctcc
acgtgggatattatagctgaaaagttgggctttatgctggtatttggagatctagtcttc
attcctttcactttcagtatccagggatggtggcttttgaaaaacaaagttgagctaacg
aaagttgctgctgttgccaattgcttggttttccttgttggttatcgagtatttagagga
gctaacaagcaaaagcatatatttaagaaggatcctaaagctcccatatggggtaaagct
ccaaaagttattggaggaaagctgcttgcctctggttactggggtattgcaagacactgc
aattaccttggtgacttactgctagcactttcattcagcttgccgtgcggaataagctct
gccattccatacttttatcctacatacctccttattctacttatttggagggagagacga
gatgaagcaaggtgttcgcagaagtacaaggaaatctgggcagaatactgccagctagtt
ccatggaggatactgccatatgtgtactaa

DBGET integrated database retrieval system