KEGG   Musa acuminata (wild Malaysian banana): 103979689Help
Entry
103979689         CDS       T03447                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 4-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00061  Fatty acid biosynthesis
mus00071  Fatty acid degradation
mus01100  Metabolic pathways
mus01212  Fatty acid metabolism
mus04146  Peroxisome
Module
mus_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    103979689
   00071 Fatty acid degradation
    103979689
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103979689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mus01004]
    103979689
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mus04147]
    103979689
Enzymes [BR:mus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     103979689
Lipid biosynthesis proteins [BR:mus01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   103979689
Exosome [BR:mus04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   103979689
  Exosomal proteins of breast cancer cells
   103979689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 103979689
NCBI-ProteinID: XP_009394139
UniProt: M0SJM0
Position
3
AA seq 655 aa AA seqDB search
MKHLLEVEKGREATDGRPSVGPAYRSAFAKDGFPPPIPGVDSCWDVFRLSAERHPGNRML
GRREVVDGKAGEYVWITYKEVYDTVIKVGASIRSRGVDQGGRCGIYGANCPEWVVSMEAC
NAHGIYCVPLYDTLGAGAVEFILCHAEVQIAFVEEKKIAEVLKTLQNSSKFLRTIVSFGK
VTLEQREAVEKSGLAIFEWDEFLLLGCNNHFDLPVKKKDDICTIMYTSGTTGDPKGVMIS
NNSIITLISGVDRLLHCVNEQLHEDEVYMSYLPLAHIFDRVIEELFIFHGASIGFWRGDV
KLLVEDIGELKPTIFCAVPRVLDRIYTGLQTKISSGGMLKQTLFNVSYKYKLHNMMRGSK
HDEAATICDKFVFNKVKHGLGGNVRLILSGAAPLATHVEQFLRVVTCAHVLQGYGLTETC
AGTFVSLPNDLSMLGTVGPPVPNVDVRLESVPEMGYDALSEVPRGEICIKGNTLFSGYYK
REDLTEEVMVDGWFHTGDVGEWQPDGSMKIIDRKKNIFKLSQGEYVAVENLENIYALVSG
IDSIWVYGNSFESFLIAIINPNKQALEHWAELTGITGDFATLCENPKAKEYILGELTKIG
KEKKLKGFELIKAVHLDPEPFDMERDLLTPTYKKKRPQLLKHYQSVIDELYKSSK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccttctagaggtcgagaagggacgggaggccaccgacggccgaccctccgtc
ggtcccgcctaccgcagcgccttcgccaaggatggcttccccccgcccatccccggcgtc
gacagttgctgggacgtcttccgcttgtccgccgagaggcatcccgggaaccggatgctt
ggccgccgcgaggttgttgatgggaaggcgggtgaatatgtctggataacttataaggag
gtgtatgacactgtgatcaaagttggggcttccatcagaagtcgtggggtcgatcagggt
ggtcgctgcggtatctatggtgctaactgtcccgagtgggttgttagtatggaggcatgc
aacgctcatgggatatattgtgtccctttgtatgatacacttggtgctggtgcagtagaa
tttattttatgtcatgcggaggttcagattgcttttgtagaggagaaaaagatcgcagag
gtgctgaaaactcttcaaaattcatccaaatttttgagaacaattgtcagttttggcaag
gtcacccttgaacaaagagaagcagttgaaaagtctggtttggcaatattcgagtgggat
gaattcttgctcttgggatgcaataatcattttgatctgcctgtgaagaagaaggatgac
atatgtaccattatgtataccagtgggactactggtgatcccaagggtgtcatgatatcc
aacaatagcataattactcttatctctggggtagatcgccttcttcattgtgtgaatgag
cagttgcatgaagatgaggtttacatgtcatatctcccccttgcacatatctttgaccgt
gtgattgaagagctgtttatattccatggagcttcaattggattttggcgtggggatgtc
aaattattggtcgaagacattggggagttgaagccaaccatcttttgtgctgttccacgt
gtgctggaccgcatttatacaggactgcaaaccaagatttcctctggaggcatgctgaag
cagacattgtttaacgtctcttataaatacaaacttcataacatgatgagaggaagtaag
catgatgaggcagctacaatttgtgataaatttgtatttaacaaggtaaaacatgggctt
ggtggaaatgtccgactcatcttgtctggagcagctcctttagctacccatgtggaacaa
tttctacgagtggtgacatgtgcacatgttttacaaggctatggtcttacggagacatgt
gctgggacatttgtgtcattgcctaatgacctttccatgctaggaacggtaggaccacca
gtaccaaacgtcgatgtgcgtttggagtccgttcccgagatgggatatgatgctctttca
gaagttcctcgtggagaaatctgcatcaaaggaaatactttattctcaggttactacaaa
agagaagacctcacagaagaggttatggttgatggatggtttcatacaggggacgttggt
gaatggcagccggacggaagtatgaaaataattgatcgtaagaaaaacatttttaaactt
tcacaaggagaatatgttgcggttgaaaatttggagaacatatatgcccttgtttctggt
atcgattcgatatgggtatatggaaatagtttcgagtctttcctcattgctataatcaat
cccaataagcaagctcttgagcattgggctgaactgactggtattactggggattttgca
acgctctgtgaaaatccaaaagcgaaagaatacattctgggggaactaactaagattggg
aaagaaaagaagttaaagggcttcgagctcattaaagccgttcacctggatccagaacca
tttgatatggagcgtgatttgctaaccccaacatacaaaaagaagcggccacagctacta
aagcattatcagagtgtaattgatgagctgtacaaaagctccaagtga

DBGET integrated database retrieval system