KEGG   Musa acuminata (wild Malaysian banana): 103979965Help
Entry
103979965         CDS       T03447                                 

Definition
(RefSeq) farnesyl pyrophosphate synthase 1
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00900  Terpenoid backbone biosynthesis
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
Module
mus_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    103979965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mus01006]
    103979965
Enzymes [BR:mus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     103979965
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     103979965
Prenyltransferases [BR:mus01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   103979965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 103979965
NCBI-ProteinID: XP_009394514
Position
3
AA seq 356 aa AA seqDB search
MAAAGTRGAMVVGDEGDLKATFRQVYGRLKSELFEDAAFDYTDEARQWIDRMLDYNVPGG
KLNRGISVIDSYKLLKEGTQLSNEEVFLGCALGWCIEWLQAYFLVLDDIMDNSHTRRGQL
CWFRVPKVGLIAVNDGILLRNHIPQILKRHFKGKPYYVDLLDLFNEVEFQTASGQMLDLI
TTHEGEKDLSKYTMTVYNRIVQYKTAYYSFYLPVACALLLAGENLDNFVDVKNILVEMGT
YFQVQDDYLDCFGDPEVIGKIGTDIEDFKCSWLVVQALERANESQIKFLLDNYGKSDPTS
VAKVKSIYRDLDLQNVFSEYERTSYERLISAIEALPSKAVQDVLKSFLHKIYKRQK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagggacgcgcggggcgatggtggtcggagacgaaggtgatctgaaggcg
accttccgccaggtctacggtcgcctcaagtcggagcttttcgaagatgccgccttcgac
tacaccgacgaggctcgtcaatggatcgacaggatgctggactacaatgtacctggaggc
aagctgaaccgtggaatctctgtcattgatagctacaagttgcttaaagaaggaacccaa
ctcagtaatgaagaagtctttcttggatgtgcccttggttggtgtattgaatggcttcaa
gcatattttctagtccttgatgatatcatggataactcacacactagacgtggtcagcta
tgttggtttagagttcctaaggttggacttattgctgtaaatgatggaatcctacttcgc
aatcacattcctcagattcttaaaaggcattttaagggaaagccttactacgtagatctc
cttgatttgtttaatgaggttgagtttcagacagcttcagggcagatgctggatctcatt
actactcatgaaggagaaaaggatttgtccaaatacacgatgacagtttacaatcgtatc
gtgcaatacaaaactgcctattattccttctatctaccagtagcgtgtgcactgctattg
gcaggtgaaaatttggacaattttgttgatgtgaagaacattcttgttgaaatgggcaca
tatttccaagtgcaggatgactacctagattgctttggtgatcctgaagtgatcgggaag
attggaaccgacattgaagattttaaatgctcttggcttgtagttcaagctttagaacgt
gctaatgagagccaaataaaatttttgttggacaactatggaaaatctgatccaacttct
gttgcaaaagtgaaaagtatctatagagatcttgatctccagaatgtattttccgagtat
gagcggaccagttatgaacgacttatctctgcaattgaagccctgccaagcaaagcagtt
caggatgttttgaagtctttcctgcacaagatctacaagcggcagaagtag

DBGET integrated database retrieval system