KEGG   Musa acuminata (wild Malaysian banana): 103982385Help
Entry
103982385         CDS       T03447                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00052  Galactose metabolism
mus00500  Starch and sucrose metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103982385
   00500 Starch and sucrose metabolism
    103982385
Enzymes [BR:mus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103982385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103982385
NCBI-ProteinID: XP_009397581
UniProt: M0STA2
Position
4
AA seq 585 aa AA seqDB search
MGSPNRVWTAWLFVVCVYWCFCSMERNKMFVEPSHIVYEELQSVSPALVNDELKPRYHFR
SARNWLNDPNGPMYYKGIYHFFYQYNPYGSVWGNIVWAHSVSTDLINWKALAPAIYPSEP
FDIYGCWSGSATVLPGDKPVILYTGVDPEQRQVQNIAFPANLSDPYLREWTKPDYNPVIP
PELGVNASAFRDPTTAWYAPNKHWTLVVGSKRDRRGMAILYRSKDFVHWIKAKHPLHSSK
DIGMWECPDFFPVAAKGRQGLDTSACGDGVKHVLKVSLDATRYEYYTLGKYFHYMDKYVP
DVTSTDDHTGLRYDYGNFYASKTFYDPAKKRRILWGWANESDSAYTDKDKGWAGVQAIPR
SIWLDDSGRQLVQWPIEEFETLRDKHIFVKNKNIPSGGFLEIKEIQTAQADVEVTFDVAS
LEKAEEFDPYYVDDAEAFCAKKTAETKGGVGPFGLLVLASANREERTAVFFRIFKAQSKY
MVLMCHDPTRSSKRESTYKPTFAGFVDIDVTKTRKISLRSLIDHSVVESFGAGGKTCITS
RVYPSVAIGEKAHLFVFNNGAQDVKLSELNAWEITEPEMNDEIIY
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgggatcacccaatcgagtttggacagcatggctatttgtggtttgtgtttactggtgc
ttttgttccatggagaggaacaaaatgtttgtggagccatctcatatagtgtatgaagag
cttcaatctgtttcacctgccttggtaaatgacgagttaaaaccaagatatcacttccga
tccgctagaaattggctcaatgatccgaacgggcctatgtactacaaaggcatctaccac
ttcttctaccagtacaatccatacggttcagtgtggggcaacatcgtgtgggcccactcg
gtctccacggacctgatcaattggaaggcactcgcccccgccatatacccgtcggaacca
ttcgacatctacgggtgttggtcgggctccgctactgttcttcccggcgacaagcccgtg
atcctgtacaccggcgtcgaccctgagcaacgccaagtccaaaacatcgcgttccccgcc
aacctatccgacccttacctccgggaatggactaagccggactacaacccagtgataccc
ccggaacttggcgtcaacgccagtgcctttcgagacccaacaacggcgtggtacgccccg
aacaagcactggactctggttgtaggcagcaagagagacagaagaggcatggcgatcttg
tacaggagcaaagatttcgtgcactggatcaaggcgaagcacccgctgcactcctctaag
gatatcggcatgtgggagtgcccggacttcttcccggtggcggcgaagggaaggcaaggg
ttagacacgtctgcgtgcggtgacggagtgaagcatgtgttgaaggttagcttggacgcg
acgagatacgagtactatactctcgggaagtacttccattatatggataagtacgtgccg
gatgtaacatcgacggatgatcatactggtttaaggtatgattacgggaacttttacgcc
tccaagacgttctatgatcctgctaagaaaaggaggatactgtggggttgggcgaatgaa
tcggacagtgcgtataccgacaaggacaagggttgggcaggagttcaagcaattccaaga
tctatctggctagatgacagtggacgacagcttgtccaatggccaattgaggagttcgaa
acccttagagacaaacacatctttgtcaagaacaagaacatcccaagtggtggtttcttg
gaaattaaagaaatacaaacagcgcaggcggatgtggaggtgacgtttgatgttgcaagt
ctagaaaaggctgaggagtttgatccatattatgtcgacgatgctgaagcattctgcgcc
aaaaagacagcagaaaccaagggtggggttgggccatttggactgctggttttggcctca
gccaaccgagaagagagaactgctgtcttcttcaggatcttcaaagctcaaagcaagtat
atggtcctcatgtgccatgatcctaccagatcatcgaagagggaaagtacatacaaaccc
acttttgccggcttcgttgacatcgatgttacaaaaacaagaaagatatctcttagaagt
ttgattgatcactctgttgtggagagttttggagccggaggcaagacatgtatcacatca
agggtttatcctagtgtggctataggagaaaaagctcatctctttgtgttcaacaatggt
gcacaggatgtgaagctctccgaactgaatgcatgggagatcacagaaccggaaatgaat
gacgaaatcatttactga

DBGET integrated database retrieval system