KEGG   Musa acuminata (wild Malaysian banana): 103982752Help
Entry
103982752         CDS       T03447                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 1
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    103982752
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mus03032]
    103982752
   03036 Chromosome and associated proteins [BR:mus03036]
    103982752
   03400 DNA repair and recombination proteins [BR:mus03400]
    103982752
Enzymes [BR:mus01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     103982752
DNA replication proteins [BR:mus03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     103982752
Chromosome and associated proteins [BR:mus03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    103982752
DNA repair and recombination proteins [BR:mus03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     103982752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP zf-PARP PARP_reg PADR1 WGR BRCT BRCT_2
Motif
Other DBs
NCBI-GeneID: 103982752
NCBI-ProteinID: XP_009398034
UniProt: M0SRX9
Position
4
AA seq 982 aa AA seqDB search
MANPPKPWKAEYAKSGRSSCKTCKSPIDRDQLRLGKMVAATQFDGYMPMWNHAGCIFKKQ
NQIKSLDDVEGIDLLRWEDQKSIRKYVEDGSSTSTTVDNSECAIEVSQTSRATCRHCSQK
ITKGTVRVSTKAEGQGARGISWHHVNCFTTMSPSTSLEKISGWDSLSPQDKESLSAFSRK
DTSKKTEDQVTSRSAKRKAVGSDEQKTKVSKSEKRNSAGKSSTNGSKDEPNHGDFSTIGL
EKKLEEQSKLLWDIKDQLKIHVTTAELREMLEANGQDSMGSEYDLRDRCADGMLFGALGT
CPICSGSLCYSGGQYRCHGYLSAWSKCSYTTTEPVRLKAKWKIPKETSNGYLIKWFKSQK
ANKPGRVLPPPSTSKSSGRHATNLSQPSNDEKLENLKVAIAGGSAEDFADLKTKLEAAGV
KFHMKIAKDTSCLIWVGEVDNDDSEMRKARRMKLPIVRVDYLQECMRKQKKLPFDLYKIE
NFAETSRSGIVTVRVKGRSAVHEASGLQDTGHILEDGKSIYNTTLNMSDLSTGINSYYIL
QIIQEDKGSGCYVFRKWGRVGNNKIGGTKLDGMSKSDAIQEFKRLFLEKTGNPWEAWEQK
RNFEKQPGRFYPLDIDYGIKQVPKKKDLTNKKSQLAPQLMDLMKMLFNVETYRAAMLEFE
INMSEMPLGKLTKKNIQKGFEALTEIQNLVCNSDYDPAIKESLIIDASNRFFTLIPSIHP
HVIRHEDDVKAKVKMLEALQDIEIASRLVCFDGDDDESLDDKYKKLRCDITPLLHDSEDY
QLVEKYLLNTHAPTHKDWTLELEEVFALEREGEFDKFAPRRDTLQNKMLLWHGSRLTNFV
GILSQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYVDKKDPVGLMLLSEVALGEIY
ELKKATYMDKPPKGKLSTKGLGKTVPLESEHVKWKDEVVVPCGRPVPSSVRASELLYNEY
IVYDTAQVKMQFLLKVRFHHKR
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccccccgaagccatggaaggccgagtacgccaagtctgggcggtcgtcgtgc
aagacctgcaagagccccatcgacagggaccagctccgcctcggcaagatggtcgctgcc
acccagttcgatggatacatgccaatgtggaatcatgctggttgtatcttcaagaaacaa
aaccagataaaatcccttgatgatgttgagggtatagacttgcttcgatgggaggatcag
aaaagcataagaaagtatgttgaggatggatcctcaacttctactacagttgacaacagt
gaatgtgccattgaagtttctcaaacatctcgtgctacttgtaggcattgcagccagaag
attacaaaaggaacggttcgtgtttcaactaaggctgaaggccaaggtgccagaggtata
tcatggcaccatgtcaactgttttaccacgatgtctccatcaaccagtttagaaaaaatt
tcaggatgggacagcctttcccctcaagataaagaatctctttctgcattttcaagaaaa
gatacatctaaaaagacagaagatcaagtaacttccagaagtgcaaaaaggaaggcagtg
gggagtgatgagcagaaaacaaaagtttctaaatctgaaaaacgcaattcggcaggtaaa
tcatcaaccaatggaagtaaagatgagcctaatcatggtgattttagtaccattggattg
gagaagaaattggaagagcagagcaagctgttgtgggatattaaagatcagcttaagata
catgtgacgacagcagagctaagggagatgcttgaagctaatggacaagattcaatggga
tcagaatatgatctgcgagaccgttgtgctgatgggatgctttttggagcgctgggtact
tgcccaatttgttctggttctctgtgttactctggtggtcagtatcgttgtcatggctat
ttgtcagcatggagcaagtgttcatacacaacaactgaacctgtgcgtcttaaagcgaag
tggaaaattccaaaagaaacaagtaatggatacctaataaagtggtttaagtctcaaaag
gcaaataaacctggaagggtgcttcctcctccatctacaagtaaatcttcaggtagacat
gcaactaatctatctcagccttctaatgatgaaaagttagaaaacttaaaagttgctatt
gctggtggatccgctgaagattttgcagatttgaagacaaaacttgaggcagctggggta
aaatttcatatgaagattgccaaagacactagttgtttgatatgggttggcgaggtggat
aatgatgactctgaaatgagaaaagctaggaggatgaaattgcctattgttagagtagac
taccttcaggaatgtatgagaaagcagaagaagcttcccttcgatttatacaaaattgag
aattttgcagaaacatctagaagtggcatcgtcactgtgagagtgaaaggtagaagtgct
gtgcatgaggcttctggtctgcaggatactggtcacattttggaggatggaaaaagcatc
tataatacaactttgaatatgtctgatctttctactggtataaacagttattacatcctt
cagattatccaagaagataaaggatcgggctgttatgtttttcgaaagtggggacgagtt
ggtaataataaaattggagggaccaaattagatgggatgtcaaaatctgatgctattcag
gaatttaaacgtttatttctagaaaagacaggaaatccatgggaagcatgggagcagaag
cgcaattttgagaagcaacctggtagattttatccactcgatattgattatggcatcaag
caagttccaaaaaagaaagatctgaccaacaagaaaagccaacttgcacctcagttgatg
gatttaatgaaaatgcttttcaatgttgaaacatacagggctgctatgttggagtttgag
ataaatatgtctgaaatgccgcttggaaagctaaccaagaagaatattcaaaaaggattt
gaagcattaacggagatacaaaatttggtttgtaattctgactatgatccagctatcaaa
gagagcttgatcattgatgctagcaaccgttttttcactcttatcccttccatacatcct
catgtcatacgacatgaagatgatgtcaaggcaaaggtgaaaatgcttgaagctcttcaa
gacatagaaatagcttccagactggtttgttttgatggagatgacgatgagtctcttgat
gataagtacaagaagcttcgatgtgatattactcctctgcttcatgatagtgaagattac
cagctagttgagaaataccttcttaatacacatgctcctacgcacaaggattggaccctt
gaacttgaagaagtttttgctcttgaaagagaaggtgaatttgataagtttgcaccacgc
agagatacattacaaaataagatgctcctgtggcatggttcaaggttgacaaactttgtg
ggcattctcagccaaggtttgaggattgcacctccagaagctccagcaactggttacatg
tttggcaagggtatttactttgctgacctagtaagtaagagtgcacaatattgctatgtg
gacaagaaagaccctgtaggtctgatgcttcttagtgaggttgctctaggagagatctat
gagctcaagaaagctacgtacatggataagccaccgaaaggaaaactttcaaccaaagga
ttgggtaagactgtgcctctggagtcggagcatgtgaagtggaaggacgaagtcgtcgtg
ccttgtggcaggccagttccatcatcggttcgtgcatcagaattactctacaatgagtat
attgtttatgatactgctcaggtcaagatgcagttcttgttgaaagtaaggttccatcac
aagaggtga

DBGET integrated database retrieval system