KEGG   Musa acuminata (wild Malaysian banana): 103983981Help
Entry
103983981         CDS       T03447                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103983981
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mus03041]
    103983981
Enzymes [BR:mus01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103983981
Spliceosome [BR:mus03041]
 Complex C
  Other components
   Step II factors
    103983981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_19 T2SSE FtsK_SpoIIIE AAA_30 DUF2075 ABC_tran ATPase
Motif
Other DBs
NCBI-GeneID: 103983981
NCBI-ProteinID: XP_009399640
Position
5
AA seq 716 aa AA seqDB search
MMPSFPNISTSKDQQDGRKLANGDCKNQQVLARRQLILQHRKSLPIASVERRLVEEVRKN
DTLIIVGETGSGKTTQLPQFLCNAGFCRDEKIIGVTQPRRVAAVTVAKRVAEECNVELGQ
KVGYSIRFEDATSSSTRIKYMTDGLLLREALLDPLLSRYSIIIVDEAHERTVHTDVLLGL
LKKVQLARSHPTTNQHNFIKANAKGREDESRSFSPLKASESAKSTSLKLIIMSASLDARC
FSEYFGGAKAVHVHGRQYPVEVLYTYQPEPDYLDATLITIFQIHLEEASGDILAFLTGQE
EIESVERLVHDRIQQLPDGSQNLLTVPIYASLPSEQQMNAFKPAPSGFRKVILATNIAET
SVTIPGIKYVIDPGLVKARSYNPVTGMESLIIIPTSKAQALQRSGRAGREGPGKCFRLYP
ESEFSKLTDSTVPEIKRCNLSNVVLQLKALGIDDIIGFDFMEKPSRMAIVKSLEQLFLLG
ALSDDYKLSSPVGQQMARLPLDPMYSKALILAKEFKCLEEMLIVVAMLSVESIFYFPREK
MEEARAARKSFSSPEGDHITLVNVYRASAECLEKSKTTNSKEKTMEKKLNKWCRENFINY
RSLRHARDIHSQIEGHIRQMGFSPSSCGDDMLQFRRCLTASFFLNAAMKQPDGSYRALSS
SQTVQVHPSSVLFRTKADCIIFNELVRTNQNYVRNVTRVDPLWLPELAPQYYAADS
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgtcttttcccaatatttccacctccaaggatcagcaagatggcaggaagctc
gccaatggagattgtaaaaaccaacaagttctagccaggaggcagttgattttacagcac
aggaagtcattacctatcgcatcagtcgagaggagacttgtggaggaagtgagaaaaaat
gacactctgataattgttggggagaccggaagcgggaagactactcaattaccccaattt
ttgtgcaatgctggattttgccgtgatgagaaaattattggagttacacagcctcggcgg
gttgctgctgttactgttgcaaaacgtgtagctgaagaatgtaatgtcgagttaggccaa
aaggttggttattccattagatttgaggatgccacatccagctccacaaggataaagtac
atgacagacggtttgcttcttagggaagcactgttggatccattgctatctagatatagc
atcatcattgtcgatgaagctcatgaaagaacagtccatacagatgtactgctggggttg
ttgaagaaagtgcaacttgcaaggtctcatcctaccactaatcagcataattttattaag
gcaaatgccaaaggaagagaggatgagtcccgaagcttcagtcctcttaaggctagtgaa
agcgcaaaatctacttccttgaagttgatcattatgtctgctagtttggatgcaaggtgt
ttctctgagtactttggtggtgccaaagctgttcatgttcatgggcgccagtatcctgtg
gaagtactttatacttaccaacctgaaccagattatcttgatgctaccctgattaccatt
ttccagatacatttggaggaggcctctggcgacattcttgcatttttgactgggcaagag
gagattgaatcagttgaaagacttgtccatgatcgcattcagcagctacctgatggcagt
caaaatctcttaaccgtccctatttatgcgtcacttccctcagagcagcaaatgaatgcc
ttcaagcctgctccatctggttttcgcaaggtaattctagcaacaaatattgctgaaacc
tctgtaacaatacctggtatcaagtatgttatagatcctggactggtgaaagctcggtcg
tacaatccagtaacgggtatggagtcattgattatcattcccacctcaaaagcgcaagca
cttcaaagaagtggtcgtgccggacgggagggacctggaaaatgcttccggttgtaccca
gagagtgagtttagtaaacttacagattctacagttccagagattaaaagatgcaacctc
tcaaatgttgttctgcagcttaaagcccttggtattgatgatatcattgggtttgatttc
atggagaaaccttcaaggatggctatagtgaaatctttggagcagttgttcctgcttggg
gctttgagtgatgattacaaactctcaagtccagttgggcagcagatggcacggcttcct
ttggaccctatgtactcaaaggcacttatcttggctaaagagttcaagtgcttggaagaa
atgttgattgttgttgctatgctctctgtggagtctatattttactttcctcgtgaaaaa
atggaagaggcaagagctgctagaaagagtttttcaagccctgaaggagaccatataact
ttggtgaatgtatatcgcgcatctgcagaatgcttggagaagagcaaaaccacaaatagc
aaagagaaaacaatggagaaaaagttgaataaatggtgcagagagaactttatcaattat
cggtctctaagacatgcgcgagacattcatagtcaaatcgaaggtcatatccggcagatg
ggtttctctccatcatcatgtggtgatgatatgcttcagttccgcaggtgtcttacagcc
tcatttttccttaatgcagcaatgaagcaaccagatggatcatacagagctttatctagt
agtcagaccgttcaggtacacccttcgtcggtgttgtttcgtacaaaggcagactgcatc
atcttcaacgagctggttcgaacaaaccaaaactatgttcgcaacgtgactcgagtggat
ccattatggttgccagagctagctccacaatattacgctgccgatagttag

DBGET integrated database retrieval system