KEGG   Musa acuminata (wild Malaysian banana): 103984221Help
Entry
103984221         CDS       T03447                                 

Definition
(RefSeq) probable glutathione peroxidase 4
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00480  Glutathione metabolism
mus00590  Arachidonic acid metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103984221
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103984221
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103984221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin TPR_18 Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 103984221
NCBI-ProteinID: XP_009399954
UniProt: M0SWM2
Position
5
AA seq 170 aa AA seqDB search
MGAYQSAPTETSVHQFTVKDGSGRDVDLGIYKGKVLLVVNVASKCGFTNSNYTQLTELYN
KYKSKDFEILAFPCNQFLHQEPRTEQEIKDFACTRFKAEFPIFQKVKVNGPETVAVYKFL
KASKPGFMGNRIKWNFTKFLIDKEGKVIGRYGTTKSPSSIEQDIQKALGS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggggcttaccaatccgcgccgacggagacttccgtccatcaattcaccgtcaaggat
ggcagcggcagggacgttgatctggggatctacaagggcaaggtgctcctcgtcgtcaac
gttgcctccaaatgtgggttcacgaatagcaactacacccagttgactgaactgtacaac
aagtataaaagcaaagattttgagattttagcattcccatgcaatcagttcttgcatcaa
gaacctcggacagagcaggaaataaaggactttgcttgcacaagattcaaggctgagttt
ccaatttttcagaaggttaaagtaaatggaccagagactgttgctgtttacaagtttctt
aaggcaagtaaaccaggttttatgggaaataggatcaagtggaatttcaccaagtttctg
attgacaaggaaggcaaggtcatcggtcgatatgggacaacaaagtctccgtcgtccatc
gagcaagacatccagaaagcacttggaagctaa

DBGET integrated database retrieval system