KEGG   Musa acuminata (wild Malaysian banana): 103984275Help
Entry
103984275         CDS       T03447                                 

Definition
(RefSeq) polyamine oxidase-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00330  Arginine and proline metabolism
mus00410  beta-Alanine metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    103984275
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103984275
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     103984275
    1.5.3.16  spermine oxidase
     103984275
    1.5.3.-  
     103984275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 FAD_binding_3 Pyr_redox_3 FAD_binding_2 Thi4 GIDA DAO Shikimate_DH FAD_oxidored HI0933_like NAD_binding_9 Pyr_redox AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 103984275
NCBI-ProteinID: XP_009400016
Position
5
AA seq 466 aa AA seqDB search
MDSASVIIIGAGMSGISAAKTLSDAGVKEILILEATNRIGGRIRNTYFADLSVETGANWI
EGVHGEKQNPIWEMAQQLGLRTFRSDYSNLSSNTYKQDGGRYEKAAVEAAIDESEKIHSL
GEEYSKTLPPSGRNDISISTFQRLENKIPSTPLEMIVDYYSYDYEFAEPPRVTSLQNTVP
LPTFDDFGDNVYFVADERGYEILVYNLASMFLETNSHGVIVDPRLQLGKVATEIQYSGDG
ATVSTDDRSSYRADFVLVSVSIGVLQSDLIKFNPVLPKWKILALYEFDMAVYTKIFLKFP
FKFWPDGDDTEFFLYASKRRGYYPLWQHFEKQYPGANILMVTVTDEESRRIEQQDESTTK
KEAMEVLRSMFGKDIPEATDILVPRWWSNKFFRGSFSNWPLGVNRHEFDSIKAPIKRLYF
TGEHTSEHYNGYVHGAYLAGIDSANMIVQHIRDGYFEVEIKPKDSY
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggattcagcatcagttatcatcattggagcagggatgtcaggtatctcggcggcgaag
acgctttccgatgcgggcgtaaaggagatactgatcctggaggccacaaaccgcatcggt
ggccgcatcaggaacacctacttcgcagatcttagtgtggagacgggagcaaactggatt
gaaggagtgcatggtgaaaagcagaaccccatatgggagatggcacagcagcttggcctc
aggactttcagatcggactacagtaatctctcctccaacacctacaagcaagatggtggg
cgttacgagaaagcagcggttgaggcggccatagacgagtcggagaagattcacagcttg
ggagaggagtactccaaaactttgccccctagcggtcggaatgatatctccatctccacg
tttcaaaggctcgaaaacaagattccttccactcccttggaaatgatcgtggactactac
tcttacgactacgagttcgcagaacctccgagagtgacgagtctgcaaaacactgttcca
ttgcctacgtttgatgactttggggacaacgtgtactttgtggcggatgagcgaggctac
gagatcttggtgtacaacttggcctccatgttcctcgagaccaatagccatggggtcatt
gtagatccgcgtctccagcttggaaaggtggcgacggagatccagtactcgggtgatggt
gccactgtgagcacggacgacagatcaagttacagagcagattttgtgctcgtctcggtc
agcattggcgttcttcaatcagatctcatcaaatttaacccagttttacctaaatggaag
atcctggcgctgtacgagttcgacatggcagtatacaccaagatattcctcaagttccct
ttcaagttttggcctgatggagatgacacagagttcttcctgtacgccagcaagaggaga
ggatactacccactgtggcagcattttgagaagcagtacccaggagccaacatcctgatg
gtcaccgtcaccgacgaggagtccagaagaatagagcagcaggatgagtccaccaccaag
aaagaagccatggaagtgctgcgcagcatgttcggcaaagacattcctgaggccacagac
atcctcgtccccaggtggtggtccaacaagttcttccggggcagcttctccaattggccg
ctgggagtcaaccggcatgagttcgactccatcaaggcacccatcaaaaggctttatttc
accggtgagcacacaagtgagcactacaatggctacgtccatggagcgtacctcgcaggg
attgattcagcaaacatgatcgtccaacatatcagagatggatatttcgaggtcgaaatc
aagccaaaggattcgtattaa

DBGET integrated database retrieval system