KEGG   Musa acuminata (wild Malaysian banana): 103984406Help
Entry
103984406         CDS       T03447                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00010  Glycolysis / Gluconeogenesis
mus00562  Inositol phosphate metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103984406
   00562 Inositol phosphate metabolism
    103984406
Enzymes [BR:mus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103984406
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103984406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103984406
NCBI-ProteinID: XP_009400159
UniProt: M0SWT4
Position
5
AA seq 519 aa AA seqDB search
MAFAFPTLLLTLLLSSSHLPLSSPADEAFDVRRHLSTVTRYDVATETYDGSFSPSAIHDG
CRPIHLNLVARHGTRAPTKKRIKELDRLAIRLDLLLNDAKQKAGKDSLQKIPAWLWGWQS
PWKGRERGGELIVKGEEELYKLGTRVRERFPQLFDEEYHPDTFRIMATQVPRASASAVAF
GMGIFAGKGSLGPGQHRSFSVISESRASDIHLRFFDTCETYKEFRTSKEPDVEKMKEPLF
DQIASSLSSRYHLNFTRQDISTLWFLCKQEASLLDITNQACGLFNPSEVSLLEWTDDIEV
FVLKGYGESVNYRMGVPLLQDVVHSMEQAISAEEGNLAGGTSEKARLRFAHAETVVPFTC
LLGLFLEGPEFEQIQREQPLSLPPKPPQRRNWRGSSVAPFAGNNMLVLYQCPGNSSNDRL
SSGVQRNKYFVHVLHNEIPIPMPGCGQRDFCQFEVFKERIVNPHLKHDFNSVCNMKLKMP
EANCPQKPCSFTSKLSNLFGRFFPKKDHNSCIKNKKNEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgctttccccacccttcttctcacccttctcctctcttcctctcatctccct
ctctcctcacccgccgacgaggctttcgacgtccgccgacacctctcgaccgtcaccaga
tacgatgttgcaacagagacgtacgatggttccttttctccttctgccatacatgatgga
tgtagaccaattcacttaaatcttgtggcaaggcatggcacacgtgccccaaccaagaaa
cgcataaaagagttggatcggttggcaattcgtttagatttacttctcaatgatgctaag
caaaaagcaggaaaggactctctgcagaaaattccagcctggttatggggttggcagtca
ccatggaaaggtagagagagaggtggggagctaatcgtcaaaggggaggaagagctttac
aaacttggaacccgtgtgagggaaaggtttccgcaactgtttgatgaagaatatcaccct
gacacattccgaataatggcaacacaggtccctcgagcatcagctagtgctgtggcattt
ggcatgggaatatttgctgggaaaggcagccttggacctggacagcatcgttctttttct
gtgattagtgaaagtcgtgctagtgacatacatctgcggttctttgatacgtgtgaaaca
tacaaggaatttagaacaagtaaagagcccgatgttgaaaagatgaaagaacctcttttt
gatcaaattgcatcttcgttatctagtcgataccacctaaattttacaaggcaggatatt
tcaaccctctggtttctctgtaagcaggaagcatctttactggacattacaaatcaagct
tgtggcctttttaatccttctgaggtttctttacttgagtggacagatgacatagaggta
tttgtgctaaagggttatggtgaatcagttaattaccgcatgggagtaccattactccaa
gatgttgtccactcaatggagcaagcaatttctgctgaagaaggaaaccttgccggtgga
acttctgagaaagcaaggcttcgttttgcacatgctgaaacggttgttccgttcacctgt
ttgcttggactttttcttgaaggacctgaatttgaacaaattcaacgggagcaaccattg
agccttcctccaaagccaccccagaggagaaattggaggggcagcagtgtagcacctttt
gctggcaacaacatgttggtcttataccagtgtccgggcaattcttctaatgacagatta
tcctctggagttcaaaggaacaagtattttgtgcatgtgctgcacaatgaaatcccaatt
ccgatgccgggttgtggccaaagagatttttgtcagtttgaggttttcaaggaaagaatt
gtcaatccccatctgaagcatgatttcaattcggtttgcaacatgaagttgaaaatgcca
gaagccaattgcccacaaaaaccttgttcattcactagcaagttgtcaaatttatttggt
agatttttcccgaagaaagaccacaattcatgcatcaaaaacaagaagaatgaattgtga

DBGET integrated database retrieval system