KEGG   Musa acuminata (wild Malaysian banana): 103985103Help
Entry
103985103         CDS       T03447                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00906  Carotenoid biosynthesis
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
Module
mus_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    103985103
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     103985103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 103985103
NCBI-ProteinID: XP_009400988
UniProt: M0SYU2
Position
5
AA seq 595 aa AA seqDB search
MTQSCIRLSNHVTATHPRKFRRSTTGCRNFLSPSVAVPKELSRKNDAPHTPPPPPPTPRP
PKAPAEHPTPISTVAPFNPVQIVVARTIDAIESGIIVELEKRRPLPRSADPAVQISGNFA
PVPESLPEYGIEVVGRIPPDLHGVYLRNGANPMFTPTGGHHLFDGDGMIHAVTLSGPTEA
SYACRFTRTSRLSQEAAIGRAVFPKAIGELHGHTGIARLAFFGLRAAAGIVDLTKGSGVA
NAGLTYFGGRLLAMSENDLPYHVRLTPDGDLETAGRFDFSGQLNSTMIAHPKIDPLTGEL
FALSYDVARKPYLKYFHVDSKSGKKSADVAINLKQPTMIHDFAITENYAIIPDQQVVFDL
KQMLHGRSPVQCDGRKTPRFGVLPRYDDDVSRIQWIDVPGCFCFHLWNAWEEPSCGGDGR
TVVIIGSCMSPPDAIFSDEDDSRPTRSVLSEIRLDLGTGQSSRREIANGMNLEAGQVNRD
RLGRRTRFAYLAMAEPWPRCSGVAKVDLETGEVRRFEYGHGRFGGEPTFIPARRGSEEDD
GHVVGFVRDERRGESELVIVNGSTMELEATVRMPSRVPYGFHGTFVRADELRGQK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcctgtatccgactctccaaccatgtcactgccacccatcctcgcaagttc
cgtcgttcaaccactgggtgcaggaacttcctctctccttccgttgctgttcctaaagag
ttgagcaggaagaacgacgctccacacacgcctcctcctcctccccctactccacgaccg
ccgaaagctcctgcggagcacccgactcccatttctactgtcgccccttttaacccggtg
cagatagttgtcgctcgtaccatcgacgccatagaaagcggcatcattgtcgagctggaa
aagagacggcctctccctcggtccgcagaccccgcggtgcagatctccgggaacttcgca
ccagttcccgagtcgctgcccgagtatggcatcgaagtggttggccgtatcccgccggat
cttcatggcgtgtatctacgaaacggtgccaacccgatgttcacgccgaccggcgggcat
cacctctttgatggagacggcatgattcacgcggtcacgctctcgggtccgacggaggca
tcttacgcctgccggttcacccgcacgagccgcctgtcgcaggaggcagccatcggccgg
gctgtcttccccaaggccattggggagctccacgggcacacggggattgctcggctcgct
ttcttcggcctccgagctgctgccggaattgtcgatctcacaaagggaagcggcgtggct
aatgctgggctcacgtacttcggcggccgccttttggccatgtcagagaacgacctcccg
taccacgtacgtctcaccccggatggcgacctcgagacagccggacggttcgacttctcc
ggccagctcaactcaacgatgatcgcacacccaaagatcgaccccttgacaggggaactg
tttgcactgagctacgacgtcgcccgcaaaccttacttgaagtactttcacgtcgactcc
aaatccggtaagaagtctgccgacgtggccatcaacctcaagcaaccaacgatgatccat
gactttgcgatcactgagaattacgccataattcccgaccaacaagtcgtgttcgatcta
aagcagatgctgcatggccgctcgccagtccagtgcgacggccggaagacaccgaggttc
ggtgtgctccccaggtacgacgatgacgtgtcaaggatccaatggatcgacgtgcccggc
tgtttctgcttccatctgtggaacgcgtgggaggaaccttcttgcggcggcgatggacga
actgtggtgatcatcgggtcgtgcatgtcgccgccggacgcgatattctcggacgaggac
gactcgcggccgacgcgcagcgtactatcggagatccggctggacctggggaccggacaa
tcgagccggagggagatcgcgaacggaatgaacctggaggcgggtcaagtgaaccgtgac
cgactcgggaggaggacccggttcgcgtaccttgcgatggcggagccatggcccaggtgc
agcggggtggcgaaggtggacctggagacgggagaagtgaggcggttcgagtacggacat
ggccggttcgggggagagccgacgttcatccccgcccggcgcgggtcagaggaggacgac
ggccacgtggtggggttcgtccgcgacgagcggaggggcgagtcggagctggtgatcgtg
aacgggtcgacaatggagctggaggcgacggtgaggatgccgtcgagggtgccgtatggg
ttccatggcacgtttgtgagggcggatgagctgcgcgggcaaaagtag

DBGET integrated database retrieval system