KEGG   Musa acuminata (wild Malaysian banana): 103987244Help
Entry
103987244         CDS       T03447                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00450  Selenocompound metabolism
mus00970  Aminoacyl-tRNA biosynthesis
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103987244
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103987244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mus01007]
    103987244
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mus03016]
    103987244
Enzymes [BR:mus01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103987244
Amino acid related enzymes [BR:mus01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103987244
Transfer RNA biogenesis [BR:mus03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103987244
 Prokaryotic type
   Other AARSs
    103987244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 103987244
NCBI-ProteinID: XP_009403764
Position
6
AA seq 612 aa AA seqDB search
MAAGRALLSSQNGLAAVAPLSSIGYRARGLASSLPLLRRRCPSAFASSSARCCSRPHSEG
AGERVMKPEKDEAFVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLGKKVVFITGTDE
HGEKIAAAAEASGRSPREHCDTISQSYRILWRELDIAYDKFIRTTDSKHEAIVKEFYSRV
LNNGDIYRADYEGLYCVNCEEYKDEKELLENNCCPMHLKPCVRRKEDNYFFALSKYQKTL
EDYLTSNPDFVKPLFRLNEVQGWIKSGLRDFSISRSSVEWGIPVPNDDKQTIYVWFDALL
GYVSALLEEGEQTNLEQAVCSGWPASLHLIGKDILRFHAVYWPAMLLSAGLSVPNMVFGH
GFLTKDGMKMGKSLGNTLEPKDLVQRFGADAVRYFFLREVEFGNDGDYSEDRFINIVNAH
LANTIGNLLNRTLGLLKKNCQSMLAFDSIIAAEGNSFKDSVDQLVEKAKYHYENLSLSSA
CESVLDIANAGNLYMDERAPWSLFKQGGASSEMAAKDLVIILEVMRIIATALSPITPSLC
SRIYSQLGFSKEQFEAATWDDTKWGGLKAGQIMAEPKPVFARIENIDDGNEVVQNKNKDK
KKASHRQGLVEA
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggtcgagctctgttatcgtcccagaacgggctcgccgctgttgcgcccctg
tcctccataggttaccgagccagaggactcgcttcctcccttcccctcctccgccgccgc
tgcccctccgctttcgcctcgtcttccgcgcgctgctgcagtcgtccgcatagcgagggc
gccggggaacgggtcatgaaacccgaaaaggatgaggctttcgtgctcacaacccctctt
tactatgtcaatgcgccgccccatatgggcagcgcctataccaccatcgccgctgatgcc
attgcccgattccagaggcttctaggaaagaaagttgtattcatcacaggaaccgatgag
catggagaaaaaattgctgctgctgcagaagctagtggcaggagccccagagaacattgt
gatactatttcccagtcttataggattctgtggagagagctagatatagcatatgacaag
tttatccgcactactgattcgaagcatgaagcaatagtcaaagaattttactctagagtg
cttaacaatggcgatatatacagggctgattatgagggtctctactgtgtgaactgcgag
gagtacaaggatgaaaaagaattgcttgagaataactgttgcccaatgcatttaaagcct
tgtgttcgtcggaaggaagataactatttttttgcattatcaaagtatcagaaaacactg
gaagattatttaacatccaatccagattttgtgaagcctttattccgcctgaatgaggtg
caaggttggataaaaagtggactgagagatttctctatatcccgctcatccgtagagtgg
ggcatacctgtgcctaatgatgataaacaaactatatatgtctggtttgatgctttattg
gggtatgtttctgcattgttagaggagggtgagcaaacaaatttagaacaagctgtttgt
tctggttggcctgcttcactgcacttaataggcaaggatatcttgcggtttcatgcggtt
tactggcctgctatgctactatcagcaggattaagtgttccaaacatggtatttgggcat
ggattcttgacgaaggatggtatgaagatggggaaatcactaggaaatacacttgaaccg
aaggatctagtgcaaagatttggagctgatgctgttaggtattttttcttgcgggaagtg
gaatttggtaatgatggggattattcagaggatcggttcatcaacattgtgaatgcacat
cttgctaacacaattggaaaccttctgaaccgtacccttgggcttttaaagaaaaactgc
cagtcaatgttggcctttgattccattattgcagctgaaggaaactcatttaaagattct
gtagaccaattggtagagaaggccaagtaccattatgagaacctttcattatcatcagca
tgcgaatctgtcttagatattgcgaatgctggtaacctttatatggatgaacgtgctcca
tggtctcttttcaagcaaggtggtgcaagttctgaaatggctgcaaaggatctcgtcata
atactggaagtaatgagaataatagcaactgctctatctccgatcactccaagcctgtgt
tccagaatatatagccaacttgggttttcaaaggaacaatttgaagcagcaacatgggat
gataccaaatggggagggctgaaggcaggtcagataatggcagagcctaagccagttttt
gcaaggatcgaaaacattgacgatggaaatgaggtggtccaaaacaagaacaaagacaag
aaaaaagcttcgcaccggcaagggcttgtagaggcttaa

DBGET integrated database retrieval system