KEGG   Musa acuminata (wild Malaysian banana): 103987255Help
Entry
103987255         CDS       T03447                                 

Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00860  Porphyrin and chlorophyll metabolism
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
Module
mus_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    103987255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mus01007]
    103987255
Enzymes [BR:mus01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     103987255
Amino acid related enzymes [BR:mus01007]
 Aminotransferase (transaminase)
  Class III
   103987255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 103987255
NCBI-ProteinID: XP_009403776
UniProt: M0T543
Position
6
AA seq 474 aa AA seqDB search
MAGLAGVGLSWRSSTPSLVPLTSTKPSCAGRRVSIAVRNAISVEGKSYTLQKSEEIFNAA
KELMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDVDGNEYIDYVGSWGPAIIGHADEKV
NAALIEALKKGTSFGAPCVLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG
RPKIIKFEGCYHGHADPYLVKAGSGVATLGLPDSPGVPKGATIDTLTSPYNDLETIKSLF
DTHKGEIAAVILEPVVGNAGFITPKPDFLNGLREITKQDGALLIFDEVMTGFRLAYGGAQ
EYFGITPDLTTLGKVIGGGLPVGAYGGRKDIMQMVAPAGPMYQAGTLSGNPLAMTAGIHT
LRRLMEPGSYDYLEKISSDLVNGILDAGKRAGHEMCGGSIRGMFGFFFTEGPVYNFQDAK
MSDTAKFARFYRGMLEEGVYLAPSQFEAGFTSLAHTSKDIDQTVEAAERVFRRI
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcctcgcaggcgttgggctctcgtggaggtcatcgaccccgtctctcgtcccg
ctgacgtccacgaagccgtcgtgcgcgggtcgccgcgtttccatcgccgtgcggaacgcc
atctccgtcgaggggaagagctacacgctccagaaatccgaggagatctttaacgccgcc
aaggaattgatgcctggaggtgtaaattctcctgttcgagccttcaaatcagttggtggt
cagccaatagtttttgattctgttaaaggttctcacatgtgggatgttgatggtaacgaa
tacattgactatgttggttcatggggtcctgctatcattgggcatgcggatgagaaggtg
aatgctgccttgattgaggccctgaaaaaaggcacaagctttggtgctccctgtgtgtta
gagaatgtattggcggagatggtcatctcagcagtgccgagtattgagatggttcgcttt
gtaaattcaggtacagaagcttgcatgggtgttctccgccttgcacgtgcatttactggc
cgaccaaagatcatcaagtttgaaggttgttatcatgggcatgctgatccataccttgtc
aaggctggcagtggggttgccactcttggccttcctgactccccgggcgttccaaaggga
gccacgatagatactctaacctcaccttacaatgatcttgaaaccataaagagtctattt
gacacccataaaggtgagattgctgctgttatcctcgaaccagttgttgggaatgctggc
ttcatcacaccaaaacctgacttcttgaatggcctccgtgaaatcacaaagcaagatggt
gctctcctcatatttgatgaggtgatgactgggttccgtctggcttatggtggggctcaa
gaatattttggcattacacctgatctaaccacacttggaaaagtcattgggggtggcctt
cctgttggtgcttatggtggtaggaaagacatcatgcagatggttgcacctgcaggacca
atgtaccaggcaggcaccctcagcgggaatccattggcaatgactgctggcattcacact
cttagaaggttgatggagcccgggtcttatgattacctagagaaaatctcctctgatctt
gttaatggtattttggatgctggaaagagagccggtcatgagatgtgtggtgggtctatc
cgtggaatgtttggattcttttttacagagggaccggtttacaatttccaggatgcaaaa
atgagtgacactgcaaaatttgcaaggttttataggggaatgttggaggaaggtgtgtat
ctagctccctcacagttcgaggcgggattcacaagcttggcacatacatctaaagatatc
gaccaaacagtcgaggctgctgagagggtttttcgaaggatttaa

DBGET integrated database retrieval system