KEGG   Musa acuminata (wild Malaysian banana): 103987347Help
Entry
103987347         CDS       T03447                                 

Definition
(RefSeq) ornithine carbamoyltransferase, chloroplastic
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00220  Arginine biosynthesis
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
mus01230  Biosynthesis of amino acids
Module
mus_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103987347
Enzymes [BR:mus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     103987347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N cEGF
Motif
Other DBs
NCBI-GeneID: 103987347
NCBI-ProteinID: XP_009403901
UniProt: M0T5E9
Position
6
AA seq 378 aa AA seqDB search
MAAVTIFGSASLHSSIADPVRGGSHRRSSAPRLLPSSSTPARFFGTRGSRISCRSSAPAH
SAISGSKESELKSGPKDFLHISDFDKATILKIINQAVEVKALLKSGDRTFLPFKGKTMAM
IFAKPSMRTRVSFETGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSRYNDVIMARVFA
HQDILDLAKYSSVPVINGLTDYNHPCQIMADALTIVEHIGQLEGTKIVYIGDGNNIVHSW
LLLASVVPFHFVCACPKGFEPDEKTVDKARNAGISMIEITNDPKEAVRGADVVYSDVWAS
MGQKEEAAYRKQKFQGFQIDESLMEIAGPKAYFMHCLPAERGIEVTDGVIEAPNSIVFPQ
AENRMHAQNAIMLHLFGL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagtgaccatcttcggcagcgcttccctccactcctccattgccgaccctgtc
cgaggagggagtcacaggcgatcgtcggctcctcggcttcttccctcttcgtctaccccg
gcgcggttcttcggcacccgcggtagtcggatctcatgccgctcctctgcgcccgcacac
tccgccatttccggatccaaagaaagcgaactgaaatcaggaccgaaggattttctccac
atcagcgactttgacaaggctacaatccttaagatcatcaatcaggcagtggaggtcaag
gcactgttaaaatcaggagacagaactttccttcccttcaaaggaaagactatggccatg
atttttgctaagccatccatgaggacccgtgtttcatttgagacaggcttcttcttgctt
ggcggccatgccatttacctgggtcctgatgatatccaaatgggtaagcgtgaggaaact
cgtgatgttgctagagtactttcgcgctacaatgacgtcattatggcacgtgtatttgcc
catcaggatattttggaccttgccaaatattcttcggtaccagttataaatggcctgact
gactataaccatccatgccagataatggctgatgcacttacaattgttgaacatattggt
cagttggaaggaaccaagattgtctacattggagatgggaacaatattgtccactcatgg
cttctgttggcatctgtagttcctttccactttgtatgtgcttgcccaaaaggattcgag
ccagatgaaaagactgttgataaggcaagaaatgctggaattagcatgatagagattaca
aatgaccccaaggaggcagtacgaggagcagatgttgtgtattcagatgtttgggctagc
atgggccaaaaagaggaggctgcatacagaaagcaaaagttccaaggttttcagattgat
gaatcattgatggagattgcaggaccaaaagcttattttatgcattgcttaccagcggag
agaggcattgaggtcactgatggtgtcattgaagcgcccaactccatcgtcttcccccag
gctgagaaccgtatgcatgctcagaatgccatcatgctccacttatttggtctctag

DBGET integrated database retrieval system