KEGG   Musa acuminata (wild Malaysian banana): 103988119
Entry
103988119         CDS       T03447                                 

Definition
(RefSeq) ankyrin repeat protein SKIP35
Organism
mus  Musa acuminata (wild Malaysian banana)
SSDB
Other DBs
NCBI-GeneID: 103988119
NCBI-ProteinID: XP_009404918
UniProt: M0T823
Position
6
AA seq 620 aa
MEVECKTVMTREDCMHLVQERQPEKDFDENGGLRAVHDGDEGEKVDGSNVVLLPLPADDH
RISKDYACDGMKVGSRASNPLEELAVQTKEQGKNKQGKKLSRRDRMELGRLFQEAVSSHD
WELAESLVLLADSQTLNDVLCIALDAIWFLTTWGELNGITGLIKKIVSYGGSDFTRAILR
TSFFASCVYACHCRIMNLTDTVGIMAQRLHERLQECHGDEVLKAEAGMKVQKFTDWALKC
IGFHFRYQENRGGRKNNMIVEVQLQLSAFKTFLELAGDHLTGKDFTEAFDAACFPLTLFS
SSFDSGWALGISAIAVQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAERNSLD
IDVDLALVFASHYCKIGTMECLVDEGHAVDFLGPLVRASERGCMQVVQWFVNRGCGDMEL
CLALTAATSSSQVGVSAYLLPHIPQHVLAALSIEILKAAGERSRGSLDGVAFLLCSDFLG
DPAATYAVADSIARSNDEAVAPELRAFLLEQWSEAAFAEGLSSGQDHFVNFMRILRRGCS
PICLMDLPPPLAATIAYMPLYRECMEAGGQLLSQKLRGQLVEAARRIGGRWVDDDSQANE
LLEILERNLPRFFLQPLTTL
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggaggtcgagtgcaagaccgtaatgactcgagaggactgcatgcacttggtgcaggag
aggcaaccggagaaggattttgatgaaaatgggggacttagggctgtgcatgatggcgac
gagggtgaaaaggtggacggaagtaatgttgtgttactgcctctcccagctgacgatcat
cgaatctccaaagattatgcctgtgatggcatgaaggtcggatcaagggcctccaacccc
ctggaggaattggccgtccagacgaaagaacagggtaaaaacaagcaagggaagaagctt
agtaggcgcgatcggatggagctgggtcgcttgtttcaggaggcagtgagctctcatgat
tgggagcttgccgagagtctggttctgctggccgattcacaaactctcaatgatgtgctt
tgtatagcgttggacgctatatggttcttgactacatggggagaactcaatggcattacg
ggactgattaagaagattgttagctatggaggaagtgatttcacaagggcaatccttagg
acatccttctttgcttcatgtgtctatgcctgtcattgcagaatcatgaatttgactgat
acagtgggcatcatggcccaaaggttgcatgaacgattacaagaatgtcatggagatgag
gttctgaaggcagaggctggtatgaaagttcagaaattcacagattgggcccttaaatgc
atcggatttcactttcgttaccaggagaatcgaggaggaagaaagaacaacatgattgtt
gaagtacaacttcagttgtcagctttcaagacatttttggaacttgctggtgaccatctt
acaggaaaggactttactgaggctttcgatgcagcttgcttccctcttaccctcttctct
agctcttttgattctggttgggcactaggaatctctgcaattgctgtccaaggattattg
gggatgctggtggagggtggtgcagacaatgtaaaccagtgctttctggaagcttcaaga
tttgggagtacagagcttgtgcggattttactgcagatcgctgagaggaatagcttggat
attgatgtcgatctcgcccttgtatttgcctcccactactgtaaaattggaaccatggag
tgcttggttgatgagggccatgctgttgacttcctgggacctctggtgcgagcatctgag
aggggctgcatgcaggttgtccaatggtttgttaacaggggatgtggagacatggagctc
tgccttgcccttactgcagccacctctagcagccaagtgggtgtttctgcttaccttctc
ccacacattccacaacatgtgcttgctgctctgagcatcgagatcctaaaggccgcaggt
gaacgaagcaggggatcacttgacggtgtcgcttttcttctctgcagtgacttccttggt
gaccctgccgcaacatatgctgtggctgacagcatcgcaaggtcaaatgatgaggctgta
gcacccgagttgagggcttttcttctggaacagtggtccgaagctgcatttgccgaaggc
ttgagttctggacaggatcactttgtgaatttcatgaggattctgagaaggggctgttca
cccatctgtctaatggacctcccaccacccctggcagccaccattgcatatatgcctctg
tatagggagtgcatggaggcaggcggacagttgctatcgcagaaactgagaggccagctc
gtggaagccgcccgtaggattggtggcagatgggtggacgacgatagccaggcaaacgag
cttctagaaattttggagcgtaacctgccacgtttctttttgcagccattgacgactctc
tga

DBGET integrated database retrieval system