KEGG   Musa acuminata (wild Malaysian banana): 103989366Help
Entry
103989366         CDS       T03447                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00511  Other glycan degradation
mus00600  Sphingolipid metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103989366
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103989366
Enzymes [BR:mus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103989366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5
Motif
Other DBs
NCBI-GeneID: 103989366
NCBI-ProteinID: XP_009406464
Position
6
AA seq 954 aa AA seqDB search
MSENGNKKGMKDPLLSDPYSRADDPLVKVDPGQPPPLTWQRKASNKGHQLSEFTLTMGEK
LKLAPLGIRLVKQIVEEAARGQVAVIDPLKERVGTSCQGVPLGGIGVGSIGRSYKGDFQR
WQLFPGICEDKPVLANQFSAFISRSDGKKYSTVLSPGNPELIKQNSISGAGSWDWNLNGR
NTTYHALYPRAWTVYDGEPDPDLKIVCRQISPFIPHNYKESSYPVAVFTFTLTNLANSSA
AVTLLFSWANSVGGTSEFSGHHSNSKMIEKDGVRGVLLHHRTGDGLPSVTYAIAAEETTD
VHVSECPCFIISGGSNAFTARDMWCAIKEHGSFDHLDPVEMPLHSEPGSSIGAAVAASVA
LASQTTRTVTFSLAWACPEVKFPSGKIYHRRYTKFYGTHCDAAASLVRDAIIEHGSWETQ
IEEWQNPILQDRRLPSWYPVTLFNELYYLNAGGAIWTDGSPPIQSLATIEERKFFLDMSN
GDFDSLSEVIAGKNTAVNILNRMTSILEKLYAPIQSNSATGISLLEGEENIGQFLYLEGI
EYCMWNTYDVHFYSSYSLIMLFPKLELSIQRDFAAAVMMHDPEKVQTLSDGKWSARKVLG
AVPHDLGLNDPWFKVNAYNLHNTDRWKDLNPKFVLQAWRDTVATGDKRFAKAVWPSVYMA
IAYMDQFDKDKDGMIENEGFPDQTYDVWSVTGVSSYSGGLWVAALQAASAMAREVGDRAS
EELFWDKYLKAKSVYHKLWNGSYFNYDNSGSKTSSSIQADQLAGHWYARACGLMSIVDKE
KAKSTFQKIFSFNVLKFKDGKRGAVNGMRPDGTIDKSTMQSREIWPGVTYSVAAAMIQEG
MLEEAFRTAQGIYEAAWSQEGLGYSFQTPEAWNNEDQYRSLCYMRPLAIWAMQWALSLPP
NVCKEPETVLDGEADSKHTVAFSRVAKLLKLPEEETSKSILRVIYEITCGRLRS
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaatggaaacaagaaaggaatgaaagatcctctattgagtgatccatattcc
agggcagatgaccctttggtaaaggtggaccctggacaacctcctcctttaacgtggcag
aggaaagcaagcaacaagggccaccaattgtcagaattcaccctgaccatgggagagaag
ctaaaattggctcccttgggtattcgacttgtgaaacaaattgttgaggaagctgcaaga
ggacaggttgcagtgattgatcctctgaaggagcgtgttggtacatcctgccagggtgtt
cctctcggtggcattggtgtagggagtattggaagaagctacaaaggtgattttcaacgt
tggcaactgttccctggaatatgtgaagacaaacctgtactagcaaatcaattttctgct
tttatctctcgctcagatggtaagaagtattcaactgtgctatctcctgggaacccagaa
ttaatcaaacaaaattccatctcaggagctggatcttgggattggaacctaaatggaagg
aataccacctatcatgctttgtatccaagggcctggaccgtctatgatggtgaacctgac
ccagatcttaaaatagtttgccgtcagatttcaccattcattcctcacaattacaaagag
agcagttatcctgttgcagtattcacattcacactaacgaacttggcaaacagttctgct
gcagtaacattgcttttttcttgggctaattctgtgggtggaacctctgaattttctgga
catcattctaattcaaaaatgatagagaaagatggtgttcgtggagtacttttacatcac
agaactggtgatggcttgccttcagtaacatatgctattgcagcagaagagacaactgat
gtccatgtctcggagtgtccctgcttcataataagtggaggttctaatgcatttacagct
agggacatgtggtgcgcaatcaaagagcatggatcttttgaccaccttgatccggttgag
atgcctcttcattctgaacctggatcatcaattggagcagctgttgcagcttctgtggca
cttgcttcacagacaacccgcactgtgacattttctttagcatgggcttgccctgaagta
aagtttcctagtggaaagatttatcataggcgctataccaaattttatggaacacattgt
gatgcagcagcaagtcttgtgcgtgatgccattattgagcatggctcctgggagacccag
attgaagaatggcaaaatcctattctgcaagacaggaggctcccttcttggtatcctgtc
actttattcaatgaactatactatcttaatgctggaggagcaatttggacagatgggtca
cctccaattcagagtttggcaactattgaggaaagaaaattcttcctcgatatgtcaaat
ggagatttcgatagtttgtctgaggtcatagcaggaaagaatactgcagtcaatatcctt
aatagaatgacatcaatacttgaaaagttgtatgcgcccattcaatcaaactcagccaca
gggatatcattgcttgaaggagaagaaaacattggtcagtttctctatcttgaagggatt
gagtactgtatgtggaatacgtatgacgtccacttctattcatcttattccctgataatg
ctgtttccaaaactcgaactcagcattcaacgagactttgctgcagcagtaatgatgcat
gatcctgagaaggttcaaactctgagtgatggcaagtggtctgcaagaaaagttcttgga
gctgttcctcatgatcttgggcttaatgacccatggttcaaggtcaatgcttataatctt
cacaacacagatagatggaaggacttgaaccctaaatttgtacttcaggcttggagagac
acggtagccaccggtgacaagcgctttgcaaaagctgtttggccttcagtctacatggca
attgcctacatggatcagtttgacaaggataaagatggaatgattgaaaatgaaggcttt
ccggatcaaacgtatgatgtctggtcagttactggtgttagctcatatagtggaggactt
tgggtggctgctctgcaagctgcttcagccatggcacgtgaagttggtgacagagcctct
gaagaacttttctgggacaagtatctgaaagcaaaatctgtttatcacaagttgtggaat
ggttcttacttcaattatgacaacagtggtagcaagacaagctcatctattcaggctgat
cagttagctggacattggtatgctagagcatgcggtctcatgtcaatcgttgacaaggag
aaagcaaaaagtacatttcagaaaatctttagctttaatgtcttaaaattcaaggatggc
aagaggggagcagttaatgggatgagaccagatggcactattgataagtctaccatgcag
tcaagagagatatggcctggagtaacgtattcagttgctgctgcgatgattcaagaaggc
atgttagaagaagcattcagaactgcacaagggatatatgaagctgcctggtcccaagaa
ggactcgggtactcgttccagacccctgaagcttggaataatgaggatcaataccggtcg
ctctgctacatgcgccccttggcaatatgggcaatgcaatgggcattgtcactgccgccg
aatgtctgtaaagaacctgagacggttttagatggcgaggctgattctaagcacacagtg
gcattctcaagagtggctaagctgcttaaattgccagaggaagaaacttcgaagagcatt
ctccgggttatctatgaaatcacttgcggtaggctgaggtcgtga

DBGET integrated database retrieval system