KEGG   Musa acuminata (wild Malaysian banana): 103989974Help
Entry
103989974         CDS       T03447                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00130  Ubiquinone and other terpenoid-quinone biosynthesis
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    103989974
Enzymes [BR:mus01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     103989974
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     103989974
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     103989974
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     103989974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 MR_MLE_C Abhydrolase_6 Abhydrolase_1 TPP_enzyme_C Hydrolase_4 Ndr Abhydrolase_2 Abhydrolase_3 DLH Thioesterase BAAT_C TPP_enzyme_M LIDHydrolase Esterase DUF726 Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 103989974
NCBI-ProteinID: XP_009407233
Position
6
AA seq 1733 aa AA seqDB search
MFAVGVFLPYSSYFEPSPHLFVSNPRLPVLPRRALRKFRRRNPSSRSLLSLHRFDLLRCS
SNPNSRVNADSCSHRGGLEIDADGILETGDLDFPVEICTTRALPPALSLAEGFDKMKQAV
EELKSNPPRMTSGVLRFQVAVPPSTKALTWLCCQHHDLLVYPHFYLITRASSDTSLQLYL
LGALKVCGIGAAISVHGSSWARQGFSLISRYLSIDSPLIKAYGFLGINYNKMSSLMEERL
DSFYLFIPQVEVTEYKGCSVLAVTLVWDDCMSYKFTNAVHTFELYIHQMINYVHRVNIYD
EVFWMNHANGKLPLIAKKDAEMVYLNAEIVAQSAPQNNSFHKKKVPSSCQFYFRHAWTTS
IGTTMLMGSYGTNCLIKDCANINAVWASLIVEECVRLGLTYFCIAPGSRSSPLAISACGH
SHTTCYSCYDERSLAFHAVGYGKGSHKPAVIITSSGTAVSNLLPAVVEASHDFVPLLLLT
ADRPPELQDAGANQSIDQVNHFGKFVRFFNLPAATDQVPARMVLTTIDSAVHYATQVPHG
PVHINCPFREPLEDSPREWQLDCLKGLDSWLSKKEPYTKYIKMQHLFTDGHHNGQVAEII
EVIQKAKRGLLLIGAIHKEDEIFAASVLAKHLSWPVVSDILSGLRLRRVLASFHEIESLF
IDHMDHALLSHSVRSWAQPDLVLQIGSRITSKRIIQLLELCSPSSYILVDEHPCRHDPSH
IVTHRIQSTIIEFAHILRKYYFPKQAGTWNIFLKELNMMVAQEIEFQIHSESSLTEPYVA
HVIGEVLKDDSALFIGNSMVIRDADMYGRGWLCPMSFDSKMMSNLDLPFQGLRVAGNRGA
SGIDGLLSTAVGFAVGCNKQVICLIGDVSFLHDTNGLAVLNQRVTRKPITVIVINNHGGG
IFSLLPIAKRAQPDVLDKYFYTVHDVSIDRLCTAHSVKHLLVRTKTELHNALCKCRQQQT
DCVIEVESSIEGNTYFHSIMSKFACEAANQTLNFLLGLPLSGSLNNGLFLSKIDKVEYSL
YRVQLFTRLTSSQVKNDIKNFFREGFVLRIYLDNATVGLGEVAPIEIHAEDLLDVEEQLK
FMAHKLEGSEISFVPLLKGSFSQWIWKALGIPPSSLFPSVRCGIEMAILNAIAARQGSGF
LDVISGYMSSSRETQLVAGVNGSKQIQICALVDHSGTPKEIADVVSQLVDEGFSTIKLKV
ARRENPVEDAEVIQVIRQKVGYEVKIRVDANRRWTYEEAMQFGSCVKCLDLQYIEEPVCQ
EVDIVKFCDESGLPVALDETIDNLSGDFLHELKKFVHPGIVAIVIKPSVVGGFERASLIA
KWAQLHEKMAVVSSAFESSISLSTYIQYACYLEEQNAEICRIKGRTPDAAIAHGLGTYCW
LKEDVTSRGIDICIRPYSDRMVASVEDARNFIQCVQINKGSIQRNYSGEPVRSYHIKVDG
DYFSCSFKLQETGENIDLMQNITIVYLHGFLGTSQDWIPIMKGVSATAHCISIDLPGHGE
SQVQFSMDKRSKQGIDLSVESVADMLLKLISSITTGGVILVGYSMGARIALHMALKFKEK
VMGAVIVSGSPGLRDKTVRKIRGAQDESRARFLVEHGLHSFLETWYSGSLWKSLRDHPHF
SYIRSTRDRHNDIQGLAEILSSLSIGKQLSLWEDLRHLQTPLLFIVGEKDAKFRKIAQHM
CSEIRGCSKDDPHQQQKLYDTIIVPDCGHAVHLENPLPVINAIRKFVTSFEQR
NT seq 5202 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcagtcggcgtcttcctcccttactcctcctacttcgaaccctcgccgcacctc
ttcgtctccaatccccgcctccctgtcctccctcgccgcgcccttcgtaaatttcggcga
cgcaacccttcctctcgatcgcttctctcccttcaccgtttcgatcttctccgttgcagc
tcgaaccctaattctcgcgtgaatgcggacagttgtagccatcgtggagggttggagatc
gacgccgatggaatcttggaaactggggacttggattttccggtggagatttgcacgact
cgagccttgccccctgctctttcgttggcggaggggtttgataagatgaagcaggcggtt
gaagagctgaagtcgaacccaccacgtatgaccagtggtgtcctgagatttcaggttgca
gttcctcctagtacaaaagcattgacttggctttgctgtcagcatcacgatcttctggtg
tatcctcatttttatctcataactagggcatcatctgatacatctcttcagttgtattta
ttaggagcacttaaagtttgtggaattggggctgcaatttctgtccatggttcttcatgg
gcccgacaaggattcagtctaatttcaagatatctttcaattgattcacccctgataaag
gcttatgggttcttaggtatcaattacaataaaatgtcatcactgatggaggagagactt
gattcattttatcttttcatccctcaggttgaggtgactgaatataagggttgctcagta
ttagcggttaccctggtttgggatgattgcatgtcttataaatttactaatgcagttcat
acctttgagctctatattcatcagatgataaattatgttcaccgagttaacatctatgat
gaagtattttggatgaatcatgctaatgggaagttacctttgattgcaaagaaagatgct
gaaatggtttacctgaatgctgaaattgttgctcaaagtgctcctcaaaacaatagtttt
cataagaaaaaggttccatcttcttgtcagttttattttaggcatgcatggacaacttct
attggcactactatgcttatgggttcttatggcaccaattgcttgataaaggactgtgcc
aacattaatgctgtatgggcttcacttatagttgaagaatgtgttcggctaggtttgacg
tacttttgtatagccccaggatccagatcatctccacttgcaatttctgcttgtgggcat
tcccacactacttgttattcttgttatgatgaacggtcacttgcatttcatgctgttggg
tatgggaaagggtctcataaacctgcagtgatcataacgtcatctggaacagctgtgtca
aaccttcttcctgcggttgtggaggctagtcatgattttgtacctcttctcttactcaca
gctgatcgccctccagaactgcaagatgcaggagcaaatcaatccattgatcaggtgaac
cattttgggaagtttgtgaggttcttcaatcttcctgcagcaactgatcaagttcctgcg
agaatggttctcacaactattgactcagctgtgcattatgcaactcaagtgcctcatggt
cctgtacatattaattgtcccttcagagagccactagaagacagtccaagagaatggcag
ttagactgtttaaaaggactagattcatggttgtcaaagaaggagccatacaccaaatat
atcaaaatgcaacatctcttcacagatggtcatcataatggacaagttgctgagatcata
gaagttatacagaaagctaaaagaggactcctcctaattggtgcaattcacaaagaagat
gaaatctttgcagcttctgttttggcaaaacatctttcatggccagttgtcagtgatatt
ctgtctggtctacggttacgcagagtattagcttcatttcatgaaatagagtccttattt
atagatcatatggatcatgctctactctcacactcggttaggagctgggcccagccggac
ctggttcttcagattggaagcaggattacgagcaaacggattattcaattgctagagctt
tgttctccatcttcatacattttggttgacgaacacccatgccgtcatgatccttctcat
attgtgactcacaggattcagagcaccattattgaatttgctcatattttacgaaaatat
tatttcccaaagcaggctggaacatggaacatttttctgaaagagttgaacatgatggtt
gcacaggagatagaatttcaaattcactcagaaagctcacttacagagccatatgttgca
catgttattggggaagtacttaaagatgattctgccttattcattggtaatagcatggtg
atcagggatgcagacatgtatggaagaggctggttatgtcccatgagctttgatagcaaa
atgatgtcaaatttggatctaccgtttcagggccttcgagtggctggaaacagaggtgca
agtggtattgatggtttgcttagcacagctgttggttttgcagtaggatgcaacaaacag
gtgatttgcttgattggtgatgtatcttttctccatgatacaaatgggttggcagttctt
aatcaaagggtgacgaggaaacctataacggtaattgtaataaacaatcatggtggtgga
atttttagtcttttaccaattgcaaaaagagcacaacctgatgtgctggataagtacttc
tacacggtccatgatgtctcaatcgatagactttgcactgctcatagtgtgaaacatttg
ctagtgcggacaaagaccgagcttcataatgctttatgcaaatgtcggcagcaacagact
gattgtgtaattgaagttgagagcagcattgagggaaacacttattttcatagcataatg
agtaaatttgcttgtgaagctgccaaccaaacactgaattttctgttgggactcccgctt
tctggaagcttaaacaatggcctatttctcagcaagatcgataaggtggagtactcattg
tatagagtccaactttttacccggctcacttcaagccaagtgaaaaatgatataaagaat
ttcttccgtgaaggttttgttctgagaatatatttggacaatgctactgtaggattgggt
gaggttgccccaattgagatccatgcagaggatcttttagatgttgaagagcagctaaag
ttcatggctcataagttagaaggatctgaaataagttttgttccattgctcaaaggctcg
ttctctcagtggatctggaaagccttaggaattccgccttcatctctttttccaagtgtt
aggtgtggaatagagatggcaatacttaatgccatagcagcaagacagggctctggattt
ttggatgtgatctctggttacatgagctcttcaagagaaactcagctggttgcaggtgtt
aatggttcaaaacagatacaaatatgtgcacttgttgatcacagcggtactcctaaagag
atagccgatgttgtgtctcagctggttgatgagggtttcagtacaataaaactgaaggta
gcacgaagagaaaatcctgttgaagatgcagaagtcattcaagttatcagacaaaaggtt
ggatatgaagtcaaaatccgtgttgatgcgaatcggaggtggacatacgaagaggcaatg
caatttggatcttgcgtaaaatgtctcgacttacagtacattgaggaacctgtttgtcaa
gaagttgatattgtcaaattttgtgatgaaagtggcttgccagtggcattagatgagaca
atcgacaatcttagtggagatttcctccatgaactaaaaaagtttgttcatccaggaatt
gttgctatagtcatcaaaccaagtgttgttggaggatttgaaagggcatcactcattgca
aaatgggctcagttgcatgagaagatggccgttgtcagtagtgcttttgaaagtagtata
agcttatcgacatacatacaatatgcatgctatcttgaagaacagaatgctgaaatttgc
agaataaaaggaagaacaccagatgcagccatagcccacggccttggaacatattgttgg
ttaaaggaagatgtaacttccagaggtatagatatctgcatacgaccatacagtgacaga
atggtagcctctgtagaagatgctcggaatttcattcagtgtgtccaaatcaacaaaggg
agtatccagaggaactactctggcgaaccagttagatcttatcacataaaagttgatgga
gattattttagctgttcattcaagttgcaagagactggtgaaaatatagatttgatgcag
aatataacaattgtctatcttcatggcttcttgggcacaagccaagactggatcccaatc
atgaagggtgtatcagcgactgcacattgcatttccattgaccttcctggccacggggaa
tcacaggtgcaatttagtatggataagagatcaaaacaaggaattgatttatcagtcgaa
tctgttgcggatatgttgctgaagttgatctctagtatcactactggaggggtcattctt
gtcggctattcaatgggtgcaaggattgcactacacatggcactcaaattcaaagaaaag
gtcatgggagctgtcatagtttcgggaagcccaggattaagggacaaaacagttagaaaa
atccgtggtgcccaagatgaatcaagggctcgttttttagtggaacatggtttgcacagc
tttctggagacatggtactcaggcagcctatggaaaagcttaagagatcatcctcacttc
agctatattaggagcactcgcgacaggcataatgacatacaagggcttgcagaaattctc
tctagcttaagcattggaaagcaactgtcactgtgggaggacttgagacatttgcaaact
cctcttctgttcattgtgggagaaaaggatgcaaagttcagaaagattgctcaacatatg
tgcagtgaaatcagaggctgttctaaagatgatccccaccaacaacaaaaactatatgat
acaatcattgttccagactgtgggcatgctgtgcatttggagaaccctctccctgtgatt
aatgcaattaggaaatttgtaacatcttttgaacagagatga

DBGET integrated database retrieval system