KEGG   Musa acuminata (wild Malaysian banana): 103990410Help
Entry
103990410         CDS       T03447                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mus01001]
    103990410
   01009 Protein phosphatases and associated proteins [BR:mus01009]
    103990410
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103990410
Protein kinases [BR:mus01001]
 Serine/threonine kinases: Other
  Wnk family
   103990410
Protein phosphatases and associated proteins [BR:mus01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103990410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103990410
NCBI-ProteinID: XP_009407815
Position
1
AA seq 333 aa AA seqDB search
MPCVKPDPADKDAEPFVEIDPTGRYGRYDDLLGAGAVKRVYRGFDQEEGIEVAWNQVRLR
SFSDDRPMLDRLFAEVRLLKTLRHENIIALYNVWTDDDGSTLNFITEVCTSGNLRVYRKR
HRHVSLKALKKWSRQILMGLEYLHTHDPCIIHRDLNCSNVFINGNIGQVKIGDLGLAAIV
GKSHAAHSILGTPEFMAPELYEEEYTEQVDIYSFGMCVLEMVTLEIPYSECDSVAKIYRK
VTAGVRPAAMAKVKDPEVRAFIERCLARPRARPSASELLTDPFFHGIDDDGSAPHPPLAR
PPSAATATDPRNRAPVPASPDAGGAAISRLRID
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgcgtgaagccagatccggcggataaagatgcggagccattcgtcgagatcgat
cccacggggcggtacgggcggtacgacgatctcttgggcgccggcgccgtgaagcgggtg
taccgggggttcgaccaggaggaggggatcgaggtggcgtggaaccaggtccggctgagg
agcttcagcgacgaccggccgatgcttgaccggctgttcgcagaggtgcggctgctgaag
acgctgcggcacgagaacatcatcgcgctctacaacgtgtggacggacgacgatggcagc
acgctcaatttcatcaccgaggtctgcacctccggcaacctccgggtgtaccggaagcgg
caccgccacgtctcgctcaaggccctgaagaagtggtctcgccagatactgatgggcctc
gagtacctccacacccacgatccctgcatcatccaccgcgacctcaactgctccaacgtc
ttcatcaatggcaacatcggccaggtaaagataggggatctggggctagcagcgatcgtg
gggaagagccatgcagcccactcgatactggggacaccggagttcatggcaccggagcta
tacgaggaggagtacacagagcaggtggacatatactcgttcggcatgtgcgtgctggag
atggtgacgctcgagatcccctacagcgagtgcgacagcgtggccaagatctaccggaag
gtgacggccggggtgaggcctgcggccatggccaaggtcaaggaccccgaggtcagggcc
ttcatcgagcgctgcctcgcgaggccccgggctcggccctccgcctccgagctcctcacg
gaccccttctttcacggcatcgacgacgatggctctgcaccccatccacctctggctcgg
cctccttctgcggccactgccaccgatccccgcaacagggcgccggttcctgcctcaccc
gacgccggcggtgccgcaatctctcgcctccggattgactga

DBGET integrated database retrieval system