KEGG   Musa acuminata (wild Malaysian banana): 103994643Help
Entry
103994643         CDS       T03447                                 

Definition
(RefSeq) probable succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00020  Citrate cycle (TCA cycle)
mus00640  Propanoate metabolism
mus01100  Metabolic pathways
mus01110  Biosynthesis of secondary metabolites
mus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103994643
   00640 Propanoate metabolism
    103994643
Enzymes [BR:mus01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103994643
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103994643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 103994643
NCBI-ProteinID: XP_009413310
Position
8
AA seq 336 aa AA seqDB search
MSRQASKLVGSLASKIFANPTPVVPSSPLSRHFAAAPPAPAVFVDKNTRVICQGITGKNG
TFHSEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVSEAKAETKANASVIYVPPPFAAAA
IMEALEAELDLVVCVTEGIPQHDMVRVKAALDKQSKTRLIGPNCPGIIKPGECKIGIMPG
YIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFLEDPQ
TEGIVLIGEIGGTAEEDAAALIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA
QDKIKTLREAGVTVVESPAKIGVAMLDVFKQRRLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccaagcgtcgaagctggtcggatccctggcctccaagatcttcgcgaacccc
acgcccgtcgtcccctcctccccgctatcccgccacttcgcggcggcgccccctgcgccg
gcggtctttgtcgacaagaacacccgcgtcatctgccagggcatcaccggaaagaacggc
accttccacagcgagcaggccatcgagtacggcaccaagatggttggcggagtgacaccc
aagaaaggtggaacagaacacttaggtcttccagtattcaatactgtttctgaagcgaag
gctgaaacaaaggctaatgcatcagttatttatgttcccccaccatttgctgctgccgca
attatggaggcattggaagctgagttagatcttgttgtatgcgttaccgaaggaattcct
cagcatgacatggtgcgagtaaaagctgcacttgacaagcagtcaaaaactcgattgatt
ggacctaattgccctggcatcatcaagcctggagaatgcaaaattggaataatgcctgga
tatatccacaagccaggacgagttgggattgtttctcgatctggtaccttgacttatgaa
gcggtctttcaaacaactgctgttggtctaggacagtccacttgtgtaggaattggtgga
gaccccttcaatggaacaaattttgttgattgcctaagaaaattccttgaagatcctcag
actgaaggtattgttcttataggagagattggaggaactgcagaagaggatgctgctgca
ctaatacaggaaagtaaaactgagaagccagttgttgcatttatagctggacttacagca
ccaccaggtcgccgtatgggtcatgctggagcaattgtgtctggtgggaagggtacagca
caagataaaatcaaaaccctccgagaggcaggtgtaacggtggtagagtccccagccaag
atcggtgtagctatgctcgatgtttttaagcaacggcgtcttgtagattaa

DBGET integrated database retrieval system