KEGG   Musa acuminata (wild Malaysian banana): 103995784Help
Entry
103995784         CDS       T03447                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00450  Selenocompound metabolism
mus00970  Aminoacyl-tRNA biosynthesis
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103995784
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103995784
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mus01007]
    103995784
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mus03016]
    103995784
Enzymes [BR:mus01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103995784
Amino acid related enzymes [BR:mus01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103995784
Transfer RNA biogenesis [BR:mus03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103995784
 Prokaryotic type
   Other AARSs
    103995784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Viral_protease Hormone_recep
Motif
Other DBs
NCBI-GeneID: 103995784
NCBI-ProteinID: XP_009414754
Position
8
AA seq 800 aa AA seqDB search
MADSSAKKAPKLPIPGRRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNTI
YMCGTDEYGTATETKAMEENCSPKEICDKYHAIHRDVYEWFDISFDKFGRTSAPQQTEVC
QAIFHKLLDNKWLSENTMQQLYCDTCQRFLADRLVEGTCPTLDCNYDSARGDQCEKCGKL
LNPTELKDPKCKVCRTAPRIRDTDHLFLELPLLREKLEEYINTMSVAGSWSQNAIQATNA
WLKEGLRPRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYISITACYTSEWEQWWKNPD
NVELYQFMGKDNVPFHTVMFPSTLLGTGERWTMMKTISVTEYLNYESGKFSKSKGIGVFG
NDAKDTKIPTEVWRYYLLTNRPEVSDTLFTWADLQAKLNTELLNNLGNFINRVLSFIAKP
EGAGYGSIIPDASNPQSQQLTKYLGEKVGKLVDQYLDAMEKVKLKQGLKIAMSISSEGNA
YLQESQFWKLFKEDPSSCAIVMKTSAGLVYLLACLLEPFMPSFSVEVLRQLNLPLEANLS
FCDENGETDKAKRPWDFLPSGHHIGKPEPLFKELKDEDVESFRVRFAGSQAERIVKAETD
ANKVAEQLKATKITGNAKKQQNKPSGNTKAKTAETEISVSKLDVRVGLIKKVQKHPDADS
LYVEEIDVGEESPRTVVSGLVKYIPLEEMQNRKVCVLCNLKPVTMRGIKSHAMVLAASND
DHTKVELVDPPSSAAVGERVTFPGYSGEPDGILSAKSKVWEKVQVDLQSNSELVACYKDV
PFTTSAGVCKVLSIANGAIR
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcagattcctcggctaagaaggcacccaagctcccgatccccggccgccgcaacatc
ctcataaccagcgcgctgccttacgtcaacaacgtccctcacctcggcaacatcatcgga
tgcgttttgagtgcggacgtgtttgctcgctactgccgactccgggggtacaacacgata
tatatgtgtgggacggatgagtatgggactgccactgagacgaaggctatggaggagaat
tgctccccgaaggagatttgtgacaaataccatgccattcacagagacgtctatgagtgg
tttgatataagctttgacaaatttggacgtacatccgctcctcagcagaccgaagtctgc
caagcaattttccataaactactggataacaagtggctttctgaaaataccatgcagcag
ctatattgtgacacatgccaacgcttcttggcggatcggcttgttgagggtacatgccct
acattggattgtaattatgattctgcacgtggtgaccaatgtgaaaaatgtggaaaactg
ttaaatccaactgaactgaaagatcccaaatgcaaggtgtgtcgtaccgctcctcgcata
cgtgatacagatcatttgttcctagagctacccttgctgagagagaagctggaagaatac
attaacaccatgtcagtggctggatcttggagccaaaatgctattcaagcgacaaatgca
tggctgaaagaaggtctgagacctcgttgtattacaagggatcttaaatggggagttcca
gtgccacatgagaagtataaagataaggtgttttatgtgtggtttgatgcccctattgga
tatatttctatcactgcatgctacacttccgagtgggagcaatggtggaagaatcctgat
aatgtggagttgtatcaatttatgggcaaggataacgtgccatttcacacagtaatgttt
ccttctactctacttggaactggcgaaaggtggaccatgatgaagacgataagtgtcaca
gaatatttaaattatgaatcaggaaagttttctaaaagtaagggaattggagtttttggt
aatgatgccaaggatacaaagattcctactgaagtatggagatactatttgttgacgaat
aggcctgaggtatcggacacattgtttacatgggcagacttgcaggctaagctgaatact
gagttgctgaacaacttagggaatttcatcaatcgtgttctaagctttattgcaaagcca
gaaggagcaggatatgggtcaatcattcctgatgcttcaaatccacaatctcagcagcta
acaaaatatttaggagaaaaagttggtaaattggttgaccaatatctggatgctatggaa
aaggttaaactaaaacaaggtctaaagattgcaatgagcatatccagtgaaggaaatgca
tatctccaagaaagccaattctggaagctgttcaaagaagatccatcttcttgtgccatt
gtgatgaagacctcagctgggcttgtctaccttcttgcatgtttgttggaaccattcatg
ccttcattttctgttgaagtgctaaggcagctcaatttacctctggaagccaatctctcc
ttttgtgatgaaaatggagaaactgacaaagcaaagagaccttgggattttctgccatct
ggtcaccatatagggaaacctgaaccactgtttaaggaactgaaagatgaagacgtggaa
tccttcagggtgagatttgctggtagtcaagctgagagaattgtgaaggctgaaactgat
gcaaataaagttgctgagcaactaaaagccacaaagataacaggtaatgcaaagaaacaa
caaaataagccttctggcaatacaaaagcaaaaactgctgaaacagagatttcggtttcg
aaacttgatgtacgtgttggcctcataaagaaggttcagaagcatccagatgctgattca
ctttatgtagaagaaatcgatgtaggtgaagaatcaccaagaactgttgttagtggtctt
gtgaaatatattcctcttgaagaaatgcagaatcggaaagtatgtgttctgtgcaaccta
aagccagtcaccatgcgaggcatcaaatcacatgcaatggtcttggctgcatcaaatgat
gaccacacaaaggtggagttggttgacccaccttcatcagctgcagtgggcgagcgagta
acctttcctggatactcgggggagcctgatggcatcttaagtgccaagagcaaagtttgg
gagaaggtgcaggttgatctgcagtccaattcagagttggtagcgtgctacaaggatgtt
cccttcacgacatctgctggtgtttgcaaagtattatccattgcaaatggagccataagg
tga

DBGET integrated database retrieval system