KEGG   Musa acuminata (wild Malaysian banana): 103997527Help
Entry
103997527         CDS       T03447                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00480  Glutathione metabolism
mus00590  Arachidonic acid metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103997527
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103997527
Enzymes [BR:mus01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103997527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103997527
NCBI-ProteinID: XP_009417046
Position
9
AA seq 111 aa AA seqDB search
MHRDCRFEVLAFPCNQFASQEPGTIEEIKETACTVFKAEFPIFDKIEVNGNNAATLYKFL
KSKKGGFPGSRIKWNFTKFLVDKDGNVIDRYSPTTSPLKIEKDIQKLLATS
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcgactgccgatttgaagtattagcatttccttgcaatcagtttgccagtcag
gagccaggaaccattgaagaaattaaggagactgcctgcacagtgttcaaagctgagttt
cctatatttgataagattgaagtgaatggcaacaatgcagcaactctgtacaagttcttg
aaatcaaagaaaggtgggttcccagggtctcgcatcaagtggaacttcacaaagtttctc
gtggacaaagatgggaatgtcattgatagatattcaccgacgacatcacccttaaaaatc
gagaaggacattcagaagctgttggcaacttcatga

DBGET integrated database retrieval system