KEGG   Musa acuminata (wild Malaysian banana): 103998719Help
Entry
103998719         CDS       T03447                                 

Definition
(RefSeq) (DL)-glycerol-3-phosphatase 2
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mus01009]
    103998719
Enzymes [BR:mus01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     103998719
Protein phosphatases and associated proteins [BR:mus01009]
 HAD phosphatases
  Other HAD phosphatases
   103998719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD CW_binding_2
Motif
Other DBs
NCBI-GeneID: 103998719
NCBI-ProteinID: XP_009418548
UniProt: M0U2P4
Position
9
AA seq 239 aa AA seqDB search
MATPLLPRVRAPITHVIFDMDGLLLDTEPFYTLVQEKILARFGKTFDWSLKAQMMGKKAI
ESARIFVRESGLDGLLTPEAFLEEREGMLQDLFPTCQQLPGVKRLVSHLHAKGIPMCIAT
GSHKRHFALKTQNHGEIIAMMHHVVMGDDPEVTKGKPSPEVFLAAAKRFEGSVDLSKVLV
FEDAPSGVAAAKNAGMNVIMVPDPCLDASHQKEADQVLGSLMDFEPKEWGLPPFDPSNE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccgctcctcccccgcgttcgagcccccatcacccacgttatctttgacatg
gacggcctcctcctcgacacggaaccgttctacacgttggtgcaggagaagatcctggcg
aggtttgggaagaccttcgactggtctctcaaggcccagatgatggggaagaaggccatt
gagtccgcccgaatcttcgtccgcgagtccggcctcgatggcctcctcacgcccgaggcc
ttcctcgaggagcgggaagggatgctgcaggacctctttcccacgtgccagcagttgccc
ggtgtcaagagacttgtcagtcatctccatgctaaggggatacctatgtgtattgcaaca
ggatctcataagcgacactttgctctgaagacgcaaaatcatggtgagataattgctatg
atgcaccatgtggtcatgggtgatgatccagaagtgacaaaaggcaaaccttctcctgaa
gtatttcttgctgctgcaaaaagattcgagggtagcgtggacctaagcaaggttttagtt
tttgaagatgcaccatcaggagtagcagcagctaaaaatgccgggatgaatgtgattatg
gtcccagatccttgtttggatgcttcgcatcagaaagaagcagaccaggttcttggttcc
ctaatggatttcgagccaaaagaatggggcctgccgccgttcgacccgagcaatgaataa

DBGET integrated database retrieval system