KEGG   Musa acuminata (wild Malaysian banana): 104000653Help
Entry
104000653         CDS       T03447                                 

Definition
(RefSeq) serine/threonine-protein kinase GRIK2 isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
mus  Musa acuminata (wild Malaysian banana)
Brite
KEGG Orthology (KO) [BR:mus00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mus01001]
    104000653
Enzymes [BR:mus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104000653
Protein kinases [BR:mus01001]
 Serine/threonine kinases: Other
  CAMKK family
   104000653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Seadorna_VP7 RIO1 WaaY Pox_ser-thr_kin Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104000653
NCBI-ProteinID: XP_009421138
Position
1
AA seq 401 aa AA seqDB search
MCWDSVSITDLIDMGCCGCFGFLRKRHRSLMPLRGSGAPLSQEFLLPENMDDADGIFYNG
DYANTLDGSDTDLQRPSKRSEEIISDRAKKGLICREVPVKETRKVIVSEDNSGNKMVNEY
IRECKIGSGSYGKVVLYRSIKDGKQYAIKIFHKSHLLKLRVAPSETAMTDVFREVAIMKM
LDHPNIVNLIEVIDDPDTDHFYMVLEYVEGKWVFEGSGAGNNLGESTTRRYLRDIVAGLM
YLHSHNVVHGDIKPDNLLVTRNNNVKIGDFSVSQVFEDDNDVLWRSPGTPVFTAPECCLG
LTYRGKPADTWALGVTLYCMIFGQYPFLGDTLQDTYDKIVNSPLIIPDEINPQLRSLLEG
LLCKDPQNRFTLRVVSEHPWVVGDEGPIPEYLCKCRRKSSA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgggatagcgtctccatcactgacctaatagatatgggttgctgtggttgcttt
ggatttttgagaaagcgccatcgatccctaatgcctctcagaggctctggtgcccccttg
tcccaggagttccttctgccagaaaatatggatgatgctgatggtatcttctacaacgga
gactatgcaaacactctagatggaagtgacactgatttgcagcggccatcgaaacgttct
gaagaaattatctcggatagagctaaaaagggattgatatgtagggaagtcccggttaaa
gaaactaggaaggttattgtttctgaggataatagtggaaataagatggttaatgaatac
atccgggaatgtaagattggttctggtagctatggcaaagtggtcctgtaccgaagcatc
aaggacggaaagcaatatgcaattaagattttccataaatcacatttgttaaagttgcgt
gtggctccttctgaaactgcaatgactgatgtttttcgggaggtagcgatcatgaaaatg
ttggaccatccaaatatagttaatctcattgaggtcattgatgacccagacacagatcac
ttctatatggtactggaatatgttgaaggcaagtgggtattcgagggttctggtgcaggt
aataatttaggagaaagtaccactagaagatacttgcgagacatagttgctggcctcatg
tatctccattctcataatgtcgtccatggagatattaaacctgataaccttttggtgaca
agaaacaacaacgtaaagataggggacttcagtgttagccaggtctttgaggatgataat
gatgtgctctggagatccccaggaacccctgttttcactgcacctgaatgctgtctaggt
ttaacctaccgtggtaagcctgccgacacatgggccctaggtgtcactttgtattgcatg
atattcgggcaatatccttttctgggggatacacttcaggacacatacgacaagattgtc
aacagcccactgatcattcctgatgaaataaatccacaactgagaagtttgctagaaggg
cttctctgcaaagatccccagaaccggtttaccttgcgtgttgtatcggagcatccttgg
gtcgttggcgatgagggtccgatcccggagtacttgtgtaagtgcaggcgaaagtcttct
gcgtga

DBGET integrated database retrieval system