KEGG   Musa acuminata (wild Malaysian banana): 104000926Help
Entry
104000926         CDS       T03447                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like isoform X1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00520  Amino sugar and nucleotide sugar metabolism
mus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    104000926
Enzymes [BR:mus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     104000926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 104000926
NCBI-ProteinID: XP_009421356
Position
10
AA seq 437 aa AA seqDB search
MKQLHKQSSLNQTQLIPTYAAKPAKPQARPSSAASSPLRAAAGYLLREQRLLFVLAGAVI
ASTFFLLHPYYHSLSRPHPYDHLSHRLLPTFRHPSSPSFSASDGGGSVGVGGGGRRIPVG
LKKPSKRIVVTGGAGFVGSHLVDKLLGRGDSVIVIDNFFTGRKDNVVHHFGNPRFELIRH
DVVEPILLEVDEIYHLACPASPVHYKYNPIKTIKTNVMGTLNMLGLAKRIGARFLLTSTS
EVYGDPLEHPQKETYWGHVNPIGVRSCYDEGKRTAETLTMDYHRGAEVEVRIARIFNTYG
PRMCLDDGRVVSNFVAQALRKEPMTVYGDGKQTRSFQYVSDLVDGLVVLMEGEHIGPFNL
GNPGEFTMLELAEVVKEVIDSSATIEFRPNTADDPHMRKPDISKAKELLNWEPKVTLRQG
LPLMVTDFQKRLLSADN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctccacaaacaatccagcctcaatcagacccaactgatccccacgtacgcg
gccaagcccgccaagccgcaggcccgcccatcctctgctgcttcctcccctctgcgcgcc
gccgccgggtacctactccgcgagcagcgcctcctcttcgtcctcgcaggcgccgtaatc
gcctccaccttcttccttctccacccctactaccactccctctcccgtccccacccctac
gaccacctctcccatcgccttctccccactttccgccacccctcctccccttctttttct
gcgtccgatggcggcggaagcgtcggtgtaggtggcggtgggaggaggataccagtgggg
ctcaagaagccgtcgaagcggatcgtggtgacggggggcgccggcttcgttggaagtcac
ctggtggacaagcttttgggcaggggggatagcgtgatcgtgatcgataatttcttcacg
gggaggaaggataatgtagtgcatcacttcggaaacccgaggtttgagctgatccgccac
gacgttgtcgagccgatcttgctggaggtcgacgagatctaccatctcgcctgcccggcc
tcacctgtacactacaaatacaaccctatcaagactatcaagacaaatgtgatgggaacg
ttgaacatgttaggattggcaaagagaattggagctagattcctgttgacgagtactagt
gaggtatatggtgatccacttgagcatccacagaaggagacatactggggccatgtcaat
cctataggtgttaggagctgttatgatgaaggaaagagaacagcagaaactttgaccatg
gattaccaccgtggtgctgaagttgaggtccgtattgcacggatattcaatacatatgga
cctcgcatgtgcctagatgatggccgtgttgtcagcaactttgttgcacaggcacttcgt
aaagaacccatgacagtttatggtgatggaaagcaaacccgaagtttccaatatgtttca
gatttggttgatggattagtagtactaatggaaggtgagcacattggacctttcaacttg
ggtaatccaggggagttcaccatgctggagctagctgaggttgtgaaagaagtcattgat
tcttctgcaaccattgaattcagacccaatactgcagatgatcctcatatgcgaaaacct
gatatatcaaaggcaaaggaactgctgaattgggagccgaaggttacattgcggcaaggg
ttacccctaatggtgacagacttccagaagcgtctcctaagcgccgacaactga

DBGET integrated database retrieval system