KEGG   Musa acuminata (wild Malaysian banana): 108951246Help
Entry
108951246         CDS       T03447                                 

Definition
(RefSeq) uncharacterized protein LOC108951246
  KO
K02890  large subunit ribosomal protein L22
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mus00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    108951246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mus03011]
    108951246
Ribosome [BR:mus03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    108951246
  Bacteria
    108951246
  Archaea
    108951246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 108951246
NCBI-ProteinID: XP_018673807
UniProt: M0U4Z6
Position
9
AA seq 267 aa AA seqDB search
MVGWQRCLRSVLRQVNTMMERNGRSSAIGYDACTKLYSPGQFAHPWIVSDISSSRIGRPS
YQYLQHLQISSSRKLFAEEDANIVPISSPLTPLMGDPMKTGKKDGLSKPLRVQAIKKDIR
QSPKKVNLVAKLVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANAAHNHGLNPDRLLV
DEAFVGKGVHLKRISYHAKGRSGIMVRPKCRLTVVVRETTPEEEAKIAKLRVSNFKKLTR
RERQLFPHQLIETTPRWGRKREAAAPV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtgggatggcaaaggtgcctacgttctgttcttcgccaggtcaataccatgatggag
cgcaatggccgttcatctgccattgggtatgatgcttgcactaagctctattcaccaggc
caatttgcacatccatggatagtttctgatatttcttcctcaagaattggaaggccttcc
tatcaatatttgcaacatttgcaaatttccagttcgaggaaactgtttgcggaagaagat
gcaaacattgtacctatttcatcccctttgacaccacttatgggggatcctatgaagact
ggaaaaaaggatggactatcaaaaccattgagggttcaagctattaagaaagatataaga
cagagtcccaagaaggttaatctggttgctaaactagtacgtggaatgcgtgttgaagat
gctctgttgcaactgcaagtaactgtcaaacgagctgcaaagaccgtctatcaggtgata
cattcagcccgagctaatgcagctcataatcatggactgaacccagatcgtcttcttgtt
gacgaagccttcgtcgggaagggtgtgcatctgaagcggatatcctaccatgccaaaggg
aggagtgggatcatggtgagacccaaatgtcgcctgacggtggtggtgagagaaaccacc
ccagaagaggaggcgaagatcgccaagctgcgggtcagcaacttcaagaagctgacgagg
cgggagaggcagctcttccctcatcagctcatcgagaccactcccaggtggggcagaaag
cgggaagcggctgcaccggtgtaa

DBGET integrated database retrieval system