KEGG   Mycolicibacterium vanbaalenii: Mvan_0544Help
Entry
Mvan_0544         CDS       T00449                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00624  Polycyclic aromatic hydrocarbon degradation
mva01100  Metabolic pathways
mva01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mvan_0544
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     Mvan_0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-ProteinID: ABM11388
UniProt: A1T2I8
Position
585788..586693
Genome map
AA seq 301 aa AA seqDB search
MGRCRATRALRITGGTIVLSWLTGQVALVTGGAAGIGLAVVERFLAEGACVGVLDRSEGD
LATIGNADGRLIAVTGDVTSYADNVTAVRETVDAFGKLDVFVGNAGIFDYFAPLVGFDGA
DLSSAFDEIFAVNVKGYLLGARAAVPELLKSDGPSMIFTVSNSGFYASGGGPLYTASKHA
VVGVVRELAYELAPKIRVNGVAPGGTVTGLRGIEDLGQGQDVLSSVPGIADIMSTTNPLQ
YAQQPADHAGLYLLLASADNSRAVTGVVINSDGGLGVRGLNQPSGGLELATGAMRIDVGS
T
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagatgcagagcaacaagagcattgcgcatcaccggagggacgatagttttgagt
tggttgaccgggcaagtcgccctggtgaccggcggggcagccggaatcggtttggccgtg
gtcgagcgtttcttggccgagggcgcatgcgtgggcgtcctggatcgctcggaaggcgac
ctggctaccatcggcaacgccgacggcaggctcatcgcggtaacaggtgacgtgacgtcg
tatgcagacaacgtcacggcggtgcgcgaaacggtcgatgcgttcggaaagctcgacgtc
ttcgtcggcaacgctgggatcttcgattactttgcccctttggtgggtttcgacggagcc
gacctcagcagcgccttcgatgagatcttcgcggtcaatgtaaagggctacctccttggt
gccagggccgccgttcctgaactcctcaaaagcgatggcccgagcatgatcttcaccgtc
tccaactctggcttctatgcctccggtggcggcccgctgtacaccgcttccaagcacgca
gtcgttggcgtagtgcgtgaactggcctacgagttggcgccgaagatcagggtgaatggc
gtcgctccaggcggcacggtaacgggcctgcgtggaatcgaggacctcggccaggggcag
gacgtgttgtcatcggtgcccggcatcgccgacattatgagtactacaaacccattgcag
tacgcgcagcagcccgccgatcacgccggcctgtatctgctactcgcgtctgcagacaac
tcgcgagcggtgaccggcgtcgtcatcaacagcgacggcggcttgggcgtgcggggcctc
aaccagccgtccggagggctggaacttgccaccggcgcgatgcgcatcgacgtcgggtca
acatag

DBGET integrated database retrieval system