KEGG   Mycolicibacterium vanbaalenii: Mvan_0597Help
Entry
Mvan_0597         CDS       T00449                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00360  Phenylalanine metabolism
mva00362  Benzoate degradation
mva00621  Dioxin degradation
mva00622  Xylene degradation
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
mva01220  Degradation of aromatic compounds
Module
mva_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Mvan_0597
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_0597
   00622 Xylene degradation
    Mvan_0597
   00621 Dioxin degradation
    Mvan_0597
Enzymes [BR:mva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     Mvan_0597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF3866
Motif
Other DBs
NCBI-ProteinID: ABM11436
UniProt: A1T2N6
Position
638815..639831
Genome map
AA seq 338 aa AA seqDB search
MIRDVYLSDVTLRDGMHAVRHQYSIEQVAMIATALDRAGVDSIEVAHGDGLAGGTCNYGF
GAHTDLEWIETVATAVKRARVATLVLPGVGTVRDLRDARRAGATVVRVGTHCTEADISAE
HITAARELGMDTVGFLMMSHMSSPSALAAQAKLMEGYGATCVYVVDSGGAMVMRDVAERV
DALRQTLLPATEIGIHAHHNLSLGVANSITAVQHGAHRVDASLAGMGAGAGNAPLEVFVA
AAERLDWTHGCDLHALQDAADDLVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAEAAAAR
YHIDARTLLEEAGRRGMVGGQEDMLVDIALDLTGADRS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgacgtctacctcagcgatgtcacgctccgcgacgggatgcacgcggtccgc
caccagtacagcatcgagcaggtggcgatgatcgccaccgcgctggaccgggcgggggtg
gactcgatcgaggtcgcgcacggcgacggattggccgggggcacctgtaactacggcttc
ggtgcgcacaccgacctggaatggatagaaaccgtcgcgacggcggtgaaacgtgcgcgg
gtggcgacgctggtgctgcccggcgtcggcaccgtgcgcgatctcagagacgccaggcgc
gccggagccacggtggtgcgggtgggcacccactgcaccgaggcggacatctccgccgag
cacatcaccgcggcccgcgagctcggtatggacaccgtcgggttcctgatgatgagccac
atgagctccccttccgcgctggctgcgcaggccaaactgatggagggctacggcgccacc
tgcgtgtacgtggtcgactcgggcggcgccatggtgatgcgcgatgtcgccgagcgtgtc
gatgcgctacgccaaaccctgctcccggcaaccgaaatcgggatccacgcgcaccacaac
ctgtcgttgggcgtggccaactcgatcaccgcggtgcagcacggcgcccaccgggtcgac
gcctccctggccgggatgggagccggtgcaggcaacgccccgctcgaggtgttcgtcgcc
gccgccgagcggctcgactggacacacgggtgtgacctgcatgcactgcaggatgccgcc
gacgatctggtgcggccgctacaggaccgtccggtgcgcgtcgaccgggaaacgctgacc
ttgggttacgccggggtgtactccagctttctgcgtcacgccgaggcggccgccgcccgc
taccacatcgacgcccgcacgctcctcgaagaggccggacgacgaggaatggtcggtggg
caggaggacatgctggtcgacatcgcgctcgacctcacgggtgccgatcggtcctga

DBGET integrated database retrieval system