KEGG   Mycolicibacterium vanbaalenii: Mvan_0788Help
Entry
Mvan_0788         CDS       T00449                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mvan_0788
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mvan_0788
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mvan_0788
    1.1.1.-  
     Mvan_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3 ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABM11626
UniProt: A1T376
Position
827407..828456
Genome map
AA seq 349 aa AA seqDB search
MRAAVYYGPNKLEVDDVAEPEPGPGTVKLKVGFNGICGTDLHEYYAGPIFVPTEPHPLTG
QQLPLTMGHEFSGTIAAVGDGVTGWSEGDRVAVEPIYKCGHCGPCRAGNYNVCQQIGFHG
LMSDGGMAEYTVVPTSMLHKLPDNVSLELGALVEPMSVAYHAATLGDVSPGDTAMVFGAG
PIGIGLWFALRGKGLDDVFVVEPSPTRRAAIEVLGARTLDPTSADVPAFIADHTRGDGAD
AVFDAAGVTPAVSTALACVGSRKPMISVAIYEKPLETPLLNLVMNESRIQGSLCYTGADF
EAVIALMGQGKYDTTGWVTRIPIDDVVDEGFEALHAGTKMKVLVDPNGA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagctgtctactacggaccgaacaagctcgaagtcgacgacgtcgccgaaccg
gagcccggtccgggcaccgtcaaactcaaggtcgggttcaacgggatttgcggcaccgac
ctgcacgagtactacgcaggcccgatcttcgtgcccaccgaaccgcacccgctgaccggc
cagcagttgccgctgaccatgggccacgagttctccgggaccatcgccgcagtcggcgac
ggggtaaccggctggagcgagggcgaccgggtcgcggtcgaaccgatctacaagtgcggc
cactgcggaccgtgtcgggcaggcaactacaacgtctgtcagcagatcggcttccacggc
ctgatgtccgacggcggcatggccgaatacaccgtggtgccgaccagcatgctgcacaag
ctgcccgacaacgtgtcgctggaactcggcgcactcgtcgagcccatgtcggtggcctat
cacgccgccacgctcggcgacgtgagccccggcgacaccgcgatggtgttcggcgccggt
ccgatcggcatcggactgtggttcgcgttgcgcggcaaaggacttgatgatgtcttcgtc
gtcgagccgtcgccgacgcggcgcgccgcgatcgaggtgctcggcgccagaacgctggac
ccgacgagcgccgacgtgccggcgttcatcgccgaccacacgcgcggcgacggggccgac
gccgtgttcgacgcagccggggtcacccctgcggtcagcacggcactggcctgcgtcggg
tcgcgaaagccgatgatcagcgtcgcgatctacgaaaagcccctggagacaccgcttctg
aatctggtgatgaacgagtcccggatccagggctcgctgtgctacaccggcgccgacttc
gaagcggtgatcgcgctgatggggcagggcaagtacgacaccaccggctgggtgacccgg
atcccgatcgacgacgtcgtcgacgagggcttcgaggcactgcacgccggcaccaagatg
aaagttctcgtcgacccgaacggagcctga

DBGET integrated database retrieval system