KEGG   Mycolicibacterium vanbaalenii: Mvan_0847Help
Entry
Mvan_0847         CDS       T00449                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00860  Porphyrin and chlorophyll metabolism
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
Module
mva_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvan_0847
Enzymes [BR:mva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mvan_0847
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mvan_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABM11685
UniProt: A1T3D5
Position
882448..883428
Genome map
AA seq 326 aa AA seqDB search
MAFPRHRPRRLRTTPAMRRLVAQTSLEPRHLVLPMFVADGIEEPRDITSMPGVVQHTRDS
LRRAAADAVAAGVGGLMLFGVPRDEDKDPTGSVGVDPDGILNRALRDLAKDLGDSTVLMA
DTCLDEFTDHGHCGVLDPTGRVDNDLTNRRYVELAVAQANSGAHMVGPSGMMDGQVAAIR
DGLDAAGYSETAILAYAAKFASGFYGPFREAVGSSLQGDRRTYQQDPGNAREALHEIQLD
IDEGADIVMVKPAMAYLDVVRAAAEISPVPVAAYQVSGEYSMIAAAGEKGWIDLPAVVLE
SLEGIRRAGADIALSYWAVDVAHWLS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcctcgtcaccggcccaggaggctgcggaccaccccggcgatgcgtcggctg
gtcgcccagacatcgctggagccaaggcatctggtattgccgatgttcgtcgccgacggc
atcgaggaaccgcgggacatcacgtcgatgcccggggtggtgcagcacacccgcgattcg
ttgcgccgggctgccgccgatgcggtcgcggcgggcgtcggcgggttgatgctgttcggt
gtccccagggatgaggacaaggatcccaccggcagcgtcggtgtcgaccccgacggcatc
ctcaatcgggcgcttcgggatctggccaaggatctcggcgacagcacggtgctgatggcc
gacacctgcctcgatgagttcaccgaccacggccactgcggggtgctcgaccccaccggc
cgggtcgacaatgacctcaccaatcgacgctacgtcgaactagcggtagcccaagcgaat
tcgggtgcccacatggtcggtcccagcggcatgatggacggtcaggtcgccgcgatccgc
gacggcctcgacgctgccgggtacagcgagaccgcgatcctggcctacgccgcgaagttc
gcgtcgggcttctacggacccttccgggaggcggtcgggtccagcctgcagggcgatcgg
cgcacctatcagcaggatcccggcaacgcgcgcgaggcgctgcacgagatccaactggac
atcgacgagggcgccgacatcgtgatggtcaaaccggcaatggcctacctcgacgtggta
cgggccgccgctgagatctcgccggttccggtggccgcctatcaggtgtcgggcgagtac
tcgatgatcgccgcggcaggcgagaagggctggatcgacctgcccgccgtggtgctggag
tccttggagggaatccggcgtgccggtgccgacatcgcgctgtcctactgggccgtcgac
gtggcccactggctgtcgtga

DBGET integrated database retrieval system