KEGG   Mycolicibacterium vanbaalenii: Mvan_1564Help
Entry
Mvan_1564         CDS       T00449                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00010  Glycolysis / Gluconeogenesis
mva00620  Pyruvate metabolism
mva00640  Propanoate metabolism
mva00680  Methane metabolism
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvan_1564
   00620 Pyruvate metabolism
    Mvan_1564
   00640 Propanoate metabolism
    Mvan_1564
  Energy metabolism
   00680 Methane metabolism
    Mvan_1564
Enzymes [BR:mva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mvan_1564
Lipid biosynthesis proteins [BR:mva01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mvan_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABM12394
UniProt: A1T5E4
Position
complement(1653034..1654734)
Genome map
AA seq 566 aa AA seqDB search
MASNTDLFDTLRSARDHLVDLMADYDKAVETFQWPRITGTFNWATDWFDAVARDNDGVAL
WIVEQDGTELKVTFDQMARRSDQVASWLRGLGVGKGDRVILMLGNQVELWESMLAVAKLG
AVIMPTTGALGSEDLADRIGRGRAGFVIANAADAAKFADVPGDYVRIAVGDPVPGWHPYS
DTAAAAAEPHDPQTSADDPLLVYFTSGTTSKPKLVEHSQISYPVGHLTTMAWIGVRPGDI
HLAISSPGWAKHAWSCFFAPWLAEATIFVYNYGRFDAAALLQQMRRAGVSTFCAPPTVWR
MLIQSDLGERPPGLREVLGAGEPLNPEVIGAVERAWGLTIRDGFGQTETTLQVGNTPGQP
VKAGSMGRPMPGVPVVLVNPLTGELADEGEICLDLSRTPLNLMTGYLGDDARNALVMRDG
YYHTGDVASRDADGYITYIGRTDDVFKSSDYKVSPFELESVLIEHPAVVEAAVVPQPDDT
RLAVPKAYISLAEGWAADADTARSILEHSRDHLAPYLKVRRLEFYELPKTISGKIRRVEL
RRREEDAHTAGQPIDTEYRYEDLVQR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaacacagatctcttcgataccctgcgcagcgcccgcgaccacctggtcgac
ctgatggccgactacgacaaggccgtggagaccttccagtggccgcggatcaccgggacg
ttcaactgggccaccgactggttcgacgcggtcgcccgcgacaacgacggcgtcgcgctg
tggatcgtcgagcaggacggcaccgaactgaaggtgacattcgaccagatggcccgccgg
tccgaccaggtggcgtcctggctgcgcggactcggggtgggcaagggcgaccgggtcatc
ctgatgctgggcaaccaggtcgaactgtgggagtccatgctcgcggtcgccaagctgggc
gcggtcatcatgccgaccaccggggcgctgggctccgaggacctggccgaccggatcggc
cggggccgcgccggcttcgtcatcgccaacgccgccgacgcggccaagttcgccgacgtg
cccggcgactacgtgcggatcgccgtcggcgacccggtgccgggctggcacccctactcc
gacaccgcagccgccgcggccgaaccccacgacccccagacctcggccgacgacccgctg
ctggtgtatttcacctccggcaccaccagcaagcccaagctggtcgagcactcccagatc
agctatccggtgggacacctgacgacgatggcgtggatcggggtgcgacccggcgacatc
cacctggccatcagctcgccggggtgggccaagcacgcgtggagttgcttcttcgcgccg
tggctcgccgaggccacgatcttcgtctacaactacggccggttcgacgccgcggcgctg
ctgcagcagatgcgccgggccggggtcagcacgttctgcgcgcccccgacggtgtggcgg
atgctgatccagtccgacctcggcgagcgcccacccggtctgcgcgaggtgctgggcgcg
ggagaaccgctcaaccccgaggtgatcggcgcggtggaacgcgcgtggggcctcaccatc
cgggacgggttcggccagaccgagaccaccctgcaggtcggcaacacgccgggccagccg
gtcaaggcgggttcgatgggccggccgatgccgggagtgcctgtggtactggtgaacccg
ctgaccggtgagctcgccgacgaaggcgagatctgcctggacctgagccggacaccgctg
aacctgatgaccggctacctcggcgacgacgcccgcaacgcgctggtgatgcgtgacggc
tactaccacaccggcgacgtcgccagccgcgacgccgacggctacatcacctatatcggc
cgcaccgacgacgtgttcaagtcctcggactacaaggtgtcgccgttcgagctggagagc
gtgctcatcgagcatccggcggtggtcgaggccgcggtggtgccacagcccgacgacacc
aggctggccgtgcccaaggcctatatcagcctcgccgagggatgggccgccgacgccgac
acggcccgatccatcctggaacactcccgagaccacctcgcgccgtacctgaaggtgcgc
cggctggagttctacgagttgccgaagacgatctcgggcaagatccgccgggtggagctg
cgccgccgggaggaagacgcccacaccgcggggcaacccatcgacaccgagtaccgctac
gaggacctggtgcagcgatga

DBGET integrated database retrieval system