KEGG   Mycolicibacterium vanbaalenii: Mvan_1988Help
Entry
Mvan_1988         CDS       T00449                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00071  Fatty acid degradation
mva00072  Synthesis and degradation of ketone bodies
mva00280  Valine, leucine and isoleucine degradation
mva00310  Lysine degradation
mva00362  Benzoate degradation
mva00380  Tryptophan metabolism
mva00620  Pyruvate metabolism
mva00630  Glyoxylate and dicarboxylate metabolism
mva00640  Propanoate metabolism
mva00650  Butanoate metabolism
mva00900  Terpenoid backbone biosynthesis
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01120  Microbial metabolism in diverse environments
mva01130  Biosynthesis of antibiotics
mva01200  Carbon metabolism
mva01212  Fatty acid metabolism
mva02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mvan_1988
   00630 Glyoxylate and dicarboxylate metabolism
    Mvan_1988
   00640 Propanoate metabolism
    Mvan_1988
   00650 Butanoate metabolism
    Mvan_1988
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mvan_1988
   00072 Synthesis and degradation of ketone bodies
    Mvan_1988
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mvan_1988
   00310 Lysine degradation
    Mvan_1988
   00380 Tryptophan metabolism
    Mvan_1988
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mvan_1988
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mvan_1988
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mvan_1988
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mva04147]
    Mvan_1988
Enzymes [BR:mva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mvan_1988
Exosome [BR:mva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mvan_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABM12807
UniProt: A1T6K7
Position
2123447..2124622
Genome map
AA seq 391 aa AA seqDB search
MPTPVIVGAARTAIGRSFKGTLVNTPPETLITTVLPEVVRRSGVDPADIDDIIFAESHYG
GGDLARYAADAVGLQHVPGQSVNRHCAGSLTAIGNASAQIGSGMERVLIAGGVQSLSMTP
LVNWRIPGPELKFEERWMPPTHVETPDAPTKDMSITVGWNTAQAAGITREEMDVWAVRSH
QRAVAAIDAGKFVDEIVPLKVTQFDGSVIDFSVDESPRRDTTLEKLAGLKVLHPEIEGFS
ITAGNASGTNDAAAGVALVDADYAAANGLNVMAKVKAWGAVGVAPRDTGLGGVKVIGRVL
DRAGLKPSDVALWEINEAFASVPIAACKEYGIDEELVNFSGSGCSLGHPIAASGARMITT
LIYELQRRGGGIGVAAMCAGGGQGGGVVIEV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgccaacacccgtcatcgtcggtgctgccaggacggccatcggccgctcgttcaagggc
acactggtcaacaccccgcccgaaaccctgatcaccacggtgctgcccgaggtcgtccgc
cgctccggcgtcgacccggccgacatcgacgacatcatcttcgccgaatcgcattacggc
ggtggcgatctcgcccgctacgccgccgacgccgtcgggctgcagcacgtgcccggtcag
tcggtgaaccggcactgcgcgggcagcctcaccgcgatcggcaacgcctcggcgcagatc
ggctccggcatggagcgggtgctgatcgccggcggcgtgcagtcgctgtcgatgacgccg
ctggtcaactggcgcatccccggccccgagctcaagttcgaagagcggtggatgccgccc
acccacgtcgaaacccccgacgcgccgaccaaggacatgtcgatcaccgtcggctggaac
acggcgcaggcggcgggtatcacccgcgaggagatggacgtctgggcagtccgctcgcac
cagcgcgccgtcgccgcgatcgatgccggcaagttcgtcgacgagatcgtcccgctgaag
gtgacccagttcgacggatcggtcatcgacttcagtgtcgacgagtctccccgtcgcgac
accacgctcgagaagctggccggtcttaaggtgctgcaccccgagatcgagggcttctcg
atcacggcaggcaacgccagcggcaccaacgacgccgccgcgggtgtggcgctggtcgat
gccgactacgccgccgcgaacggcctcaacgtgatggccaaggtcaaggcgtggggtgcc
gtcggtgtggcgccgcgtgacaccggcctcggcggcgtgaaggtcatcggcagggtgctc
gaccgggccggactcaagccgtccgatgtggcgctgtgggagatcaacgaggcgttcgcg
tccgtgccgatcgcggcgtgcaaggagtacggcatcgacgaggaactcgtcaacttctcg
ggcagcggttgcagcctcggccatcccatcgccgcttccggcgcgcggatgatcaccacg
ctgatctacgagctgcagcgccgcggcggtggcatcggtgtcgcggcgatgtgcgccggc
ggcggccagggcggcggcgtcgtcatcgaggtctag

DBGET integrated database retrieval system