KEGG   Mycolicibacterium vanbaalenii: Mvan_2804Help
Entry
Mvan_2804         CDS       T00449                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00340  Histidine metabolism
mva01100  Metabolic pathways
mva01110  Biosynthesis of secondary metabolites
mva01230  Biosynthesis of amino acids
Module
mva_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mva00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mvan_2804
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mvan_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABM13611
UniProt: A1T8W1
Position
2972542..2973897
Genome map
AA seq 451 aa AA seqDB search
MVSVSVSPGLLRRIDLRGTTLSAARLRSALPRGGVDVDTVVPKVRPIVDAVAERGAAAAL
EYGAAFDGIRPDQVRVPAERLKAALAELDPDVRTALEVAIERARAVHADQRRTDTTTTLA
PGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVDSLVIASPPQAGNAEPFK
GLPHPTILAAAALLGVDEVWAVGGAQAVALLAYGGVDTDGAELAPVDMITGPGNIYVTAA
KRICRSAVGIDAEAGPTEIAILADHTADPAHVVADLISQAEHDEMAASVLVTDSAELADA
TDRELAVQLETTVHRERVTAALGGQQSAIVLVDDIEAGIRTVNAYAAEHLEIQTVDAAAV
AGRIRSAGAIFVGPWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVDYTEA
ALKDVSGYVITLAKAENLPSHGEAVRRRFER
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcgtgagtgtatcgccagggcttctgcggcgcatcgatctgcgcggcaccacg
ctgtcggcggcccgcctgcgctcggcactgccgcgcggcggtgtcgacgtcgacaccgtc
gtgcccaaagtcaggcctatcgtcgatgcggtcgccgagcgcggagccgccgcggcgctg
gagtacggtgccgcgttcgacggtatccggcccgaccaggtgcgggttcccgccgaaagg
ctgaaggcggcgctcgccgagctcgatcccgatgtccgcaccgcgctggaggtcgcgatc
gagcgggcccgcgccgtgcacgccgatcagcgccgcaccgacaccacgaccacactcgcg
ccgggcgccaccgtgaccgagcgctgggtgcccgtcgagcgggtcggactctacgtgccc
ggcggaaacgccgtctacccgtccagcgtcgtgatgaacgtggtgcccgcccagaccgcg
ggcgtggactcgctggtgatcgccagcccgccgcaggcggggaatgctgagcccttcaag
ggccttccgcatccgacgatcctggccgcggcggcgctgctcggtgtcgacgaggtctgg
gcggtcggcggggcccaggccgtcgcgttgctggcctacggcggcgtcgacaccgacgga
gccgaactcgctccggtcgacatgatcaccgggcccggcaacatctacgtcaccgccgcc
aaacgcatctgccggtcggcggtcggcatcgacgccgaggccggccccaccgagatcgcg
atcctggccgaccacaccgccgacccggcgcacgtcgtcgcggacctgatcagtcaggcc
gagcacgacgagatggccgccagcgtcctggtcaccgacagcgccgagttggccgacgcc
accgaccgcgagctggccgtacagctggagaccaccgtgcaccgcgagcgggtgacggcc
gcgctgggtgggcagcagtcggcgatcgtcctcgtcgacgacatcgaggccgggatccgc
accgtgaacgcctacgccgccgagcacctggagatccagaccgtcgacgcggccgctgtc
gcgggcaggatccgttctgccggagcgattttcgtcggtccgtggtcaccggtgagcctc
ggtgactactgcgcaggctcgaaccatgtgctccccaccgcgggctgcgcccggcattcc
agtggattgtcggtgcagaccttcctgcgcggcatccacgtcgtggactacaccgaggcg
gcgctgaaggacgtgtcgggctacgtcatcacgctggccaaggccgagaacctgcccagc
cacggcgaagccgtgcgccggaggttcgagcggtga

DBGET integrated database retrieval system