KEGG   Mycolicibacterium vanbaalenii: Mvan_3663
Entry
Mvan_3663         CDS       T00449                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mva  Mycolicibacterium vanbaalenii
SSDB
Motif
Pfam: PEMT ICMT NnrU ERG4_ERG24 TFIID_NTD2 DUF1295
Other DBs
NCBI-ProteinID: ABM14450
UniProt: A1TBA0
Position
3895097..3895858
AA seq 253 aa
MADAAYGLWPLVIVNTLLFMAFGLSFFRPRTHRDWRAMGGYTAFLVALFTEMYGVPLTVY
LLGGWLGSRFPLLRDTHAGGHLWNDLIGWTGDPHLSPFHLASYAAIGGGFWLIAVAWRHL
HAAAQADRLATTGPYAWVRHPQYDGFLLVMLGFLLQWPTIPTLMMFPVLVYVYARLARSE
ERDAADQFGPAWNAYTARTPAFMPHLRSRPQTVPETAHSGDSRTAWHRPTPPPLPTGASP
PPSTDGSHAGGRS
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcagatgcagcctacggattatggccgctagtgatcgtgaacacgttgttgttcatg
gcttttgggctgagcttctttcgtccgagaacgcatcgagattggcgggcaatgggcggc
tacaccgcgttcttggtggcgttgttcaccgagatgtacggcgtcccgttgaccgtgtac
ctgctcggcggctggctgggatcgcgcttcccgctcctacgtgacacccacgccggcggg
cacctgtggaacgacctcatcggctggaccggcgacccgcacctgagcccctttcatctg
gccagctacgcggcgatcggtggcggtttctggctgatcgcggtcgcctggcgacacttg
catgcggccgcccaagccgatcgactcgccacaaccggcccgtatgcctgggtacgtcac
ccgcaatacgacggcttcctactagtcatgctcggcttcttgctgcagtggccgacgatt
cccacactgatgatgttcccagtgctggtttacgtctacgcgcggctggcgcgcagcgaa
gaacgcgacgcggcggaccaattcggccccgcatggaacgcgtacacggcacgcactccg
gcattcatgccgcacttgcgatctcgtccccaaaccgtgccggaaaccgctcactccggt
gacagccgcaccgcctggcatcgcccgacaccgccgcccctgcccaccggcgcctcgcca
ccgcccagcaccgacggctcccacgcaggaggtcggtcatga

DBGET integrated database retrieval system