KEGG   Mycolicibacterium vanbaalenii: Mvan_4191
Entry
Mvan_4191         CDS       T00449                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00903  Limonene and pinene degradation
mva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mvan_4191
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     Mvan_4191
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GTP1_OBG
Other DBs
NCBI-ProteinID: ABM14968
UniProt: A1TCR8
Position
complement(4498210..4499046)
AA seq 278 aa
MPGRVEGKVAFVTGAARGQGRSHAIKLAEEGADIIAIDVCKNVDNVQLDLATPGDLLETK
ARVEALGRRIIAEEVDVRDYDAMKAVVDRGVAELGRLDIILANAGIGNGGQTVETLEEDV
WQTMMDVNLTGVWKTVKAGIPHMIAGGRGGSIVLTSSVAGLKAYPQMSQYVSAKHGVVGL
MRSCATELGQHMIRVDSVHPTHVNSPMVMNDETFRMFRPDLENPGPDDIAPICQMFHTMP
RPWVEVEDITNAVMFFASDDSRYVTGVAMPIDLGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atgccaggacgggttgagggaaaggtcgcgttcgtcaccggggcggcacgcggccaaggg
cgcagtcacgcgatcaaactcgcggaggagggcgcggacatcatcgccatcgacgtgtgc
aagaacgtcgacaacgtccaactcgatctcgcgacgccgggtgacctgctggagacgaag
gcacgtgtggaggccctcggccggcggatcatcgccgaggaggtcgacgtccgtgactac
gacgcgatgaaagcggtcgtcgaccggggggtcgccgaactcggccggctcgacatcatc
ctggccaatgccggtatcggcaacggtggccagacggtcgagacgctcgaagaggacgtc
tggcagaccatgatggacgtcaacctcaccggtgtctggaagacggtgaaggcggggata
ccgcacatgatcgccgggggccgcggcggatcgatcgtcctgaccagttcggtggcggga
ctcaaggcgtatccgcagatgagtcagtatgtatcggccaagcacggggtcgtcggcctg
atgcggtcgtgcgcgacggagctggggcagcacatgatcagggtcgacagcgtgcacccc
acccacgtcaactcgccgatggtgatgaacgacgagacgttcaggatgttccgtccggat
ctggagaatcccggtccggacgacatcgccccgatctgtcagatgttccacaccatgccg
cgaccgtgggtggaggtcgaggacatcaccaacgccgtcatgttcttcgcctccgacgac
tcccgctatgtcacgggtgtcgcgatgcccatcgatctcggaagctgtctgaagtga

DBGET integrated database retrieval system