KEGG   Mycolicibacterium vanbaalenii: Mvan_4825Help
Entry
Mvan_4825         CDS       T00449                                 

Definition
(GenBank) transcriptional regulator, ArsR family
Organism
mva  Mycolicibacterium vanbaalenii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_5 HTH_20 HTH_Crp_2 HTH_24 Rrf2 HTH_IclR MarR_2 Fe_dep_repress TrmB MarR HTH_27 HTH_34 HTH_11 LexA_DNA_bind HTH_28 DUF4423 DUF2250 Crp HTH_CodY HTH_1 HTH_36 HTH_40 HTH_10 RP-C Sigma70_r4_2 OGFr_III GerE FaeA HTH_Mga
Motif
Other DBs
NCBI-ProteinID: ABM15598
UniProt: A1TEJ8
Position
complement(5163594..5163980)
Genome map
AA seq 128 aa AA seqDB search
MSTDWHNRVMPKALPSIDISAPVCCAPVAAGPMSDEDALQVALRLKALADPARVKIMSHL
YSSAAGEENSGSLAKVLGLTESTVSHHLSQLRRAGLVESDRRGMNVYHRPHRDAIGALCV
VLDPNCCA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagactggcataatcgggtcatgccgaaagcgctgcctagcatcgatatctcc
gcgccggtgtgctgtgcacccgttgcggcgggacccatgagcgatgaagacgcgctacaa
gtggcgcttcgcctgaaggcgctcgccgacccggcgcgggtgaagatcatgtcccacctc
tacagctccgcggccggggaggagaacagcggcagcctggcgaaggtcctgggcctgacg
gagtccaccgtcagtcaccatctcagccagcttcggcgggcagggctggtggaatcagac
cgtcgcgggatgaacgtctaccaccggccgcaccgcgacgcgatcggcgcgctgtgcgtg
gtgctggacccgaactgctgcgcctga

DBGET integrated database retrieval system